(data stored in ACNUC9543 zone)

EMBL: AL844507.PE27

AL844507.PE27        Location/Qualifiers
FT   CDS_pept        join(191976..192041,192355..194103)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0802800"
FT                   /product="serine/threonine protein phosphatase 2B catalytic
FT                   subunit A"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0802800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0129:mRNA"
FT                   /db_xref="GOA:Q8IAM8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAM8"
FT                   /protein_id="CAD51335.1"
FT                   /translation="MEPLPDPKNDRQVKDVEPPPAKPLSLELLYPNGTEEPPDYKALRD
FT                   HLKKEGRIRKEDCLDIIKKVIDIVSNEPNLLRLKDPITIVGDIHGQYYDLLKLLEVGGN
FT                   PDHTQFLFLGDYVDRGSFSIEVLLLLYALKINFPDRIWLIRGNHECRQMTTFFNFRDEC
FT                   EYKYDIVVYYAFMESFDTIPLSAVINGKFLGVHGGLSPDLILLNQICSFTRFQEPPRSG
FT                   IFCDILWSDPIDEDKEEHTIQTESYFPNDIRGCSYFFGYNAATTFLEKNGLLSIIRAHE
FT                   AQLEGYKMHQTNLKTGFPIVITIFSAPNYCDVYNNKGAVLKFDSNTLNIQQFSFSPHPY
FT                   HLPNFMNLFTWSLPFVSEKVTEMLYSLLNCSMNDTDEGINDIVLPKEVIQILNYIEENN
FT                   KRINEMNFNNNDDNVQYEDNGPYINQSNNNNNNNNKDNKFDDITYDDHKKEKDKRNKIS
FT                   SNGNMQDNNQLYDHSEGHNNYNDEDEFFKNVKKTDTNNNNNNEEEDEEEDEEEEEDGRK
FT                   TKDVGQVSKERTDTLRKKVQSVGRLMRVFRTLRKENELIVQLKGCSPGYRIPVGLLLSG
FT                   KEGLENELEKFTKVKEIDSINEKRPSNE"
     atggaaccac tgcctgatcc gaagaatgat agacaagtga aggatgttga gcctccacca        60
     gcaaaaccgt taagcttaga actactatat ccaaacggaa cggaagagcc accagattat       120
     aaagctctaa gagatcattt aaaaaaagag ggtcgcataa gaaaagaaga ttgtttagat       180
     ataataaaga aggtgataga tatagtaagc aatgaaccga atttattgag gttaaaggac       240
     ccaataacaa ttgttggaga tattcatggt cagtattatg atttattaaa attattggaa       300
     gttggaggta atcctgatca tactcaattt ttatttttag gagattatgt cgataggggt       360
     tcgtttagta tagaagtatt attattatta tatgctttaa aaataaattt ccctgatcgc       420
     atatggttaa tacgaggaaa tcatgaatgt cgtcaaatga caacattttt taattttaga       480
     gatgaatgtg aatataagta tgatatagta gtatattatg cttttatgga atcttttgat       540
     acaattcctt tatcagctgt aataaatggt aaatttttag gagttcatgg tggtttatct       600
     cctgatttaa tattattgaa tcaaatatgt tcatttactc gatttcaaga acctccacgt       660
     tcaggaattt tctgtgacat attatggtca gatcctattg atgaagataa agaagagcat       720
     accatacaaa ctgaatctta ttttcctaat gacataagag gatgtagtta tttttttgga       780
     tacaatgcag caacaacatt tttagaaaaa aatggtttat tatcaataat acgagcccac       840
     gaagctcagc ttgaaggata taaaatgcat cagacaaatt taaagactgg ttttcccata       900
     gttataacta tattttcagc tcctaattat tgtgatgttt ataataacaa aggtgccgtt       960
     ttaaaattcg atagtaacac attaaatata caacaattta gtttttcacc tcatccttac      1020
     catttaccta attttatgaa tttatttaca tggtccttac catttgtaag cgaaaaagtt      1080
     acggaaatgt tgtattccct tttaaattgt agtatgaatg atacggatga agggataaac      1140
     gatatcgttt tacctaaaga agtaatacaa attttaaatt atattgaaga aaataataaa      1200
     agaattaatg aaatgaattt taataacaac gatgataatg tacaatatga agataatggt      1260
     ccatatataa atcaaagtaa taataataat aataataata ataaggataa caagtttgat      1320
     gatattactt atgatgatca taaaaaagag aaagacaaaa gaaataaaat atcttctaat      1380
     ggtaatatgc aagataataa tcaattatat gatcattcag aaggacataa taattataat      1440
     gatgaagatg aattcttcaa aaatgttaaa aagacagata caaataataa taataataat      1500
     gaggaagagg acgaggaaga ggacgaggag gaggaggagg atggaagaaa aactaaagat      1560
     gtaggacaag tatctaaaga aagaacggat actctaagaa aaaaagtaca atcggtaggt      1620
     agactaatga gagtttttag aaccttaagg aaagaaaatg aattaattgt gcaacttaaa      1680
     ggatgtagtc ctggttatag aatacctgta gggttattat taagtggaaa agagggattg      1740
     gaaaatgagc tcgaaaaatt tacaaaggtt aaagaaattg atagtattaa cgaaaagagg      1800
     ccatccaacg aataa                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page