(data stored in ACNUC9543 zone)

EMBL: AL844507.PE270

AL844507.PE270       Location/Qualifiers
FT   CDS_pept        1186175..1187125
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827500"
FT                   /product="ribosomal protein L21, apicoplast, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0014:mRNA"
FT                   /db_xref="GOA:C0H4Y5"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Y5"
FT                   /protein_id="CAX64160.1"
FT                   /translation="MFFFSSKNKSFLLWASFMLIYFTNISIYVSKIHHHGLNKKIYNLN
FT                   FVSNVFKYNARRRGNSLNVLINSPAQVKLSEMEDAKDRSGKYCIIEICGKIRWVEEGRF
FT                   YDVFRIKQEENRNIYLNRILFYSNEEGNIFFGRPFLDNVRIHATVLNHFRGHKIYRLKY
FT                   KPKKNYKRFYGHRQEMTRIKINKIEYNNELLGQEKRIYNFFKDDSLYYILNRIHNIVRP
FT                   SLELKHLKKNFIEYINSFCSLKFETFYKHKGNYKKEKMLRNILKTKKLSKRPEVIEEVK
FT                   KIEEEKKKQRLTKCDPLDDFDPVVNEFMIKEHFYS"
     atgttttttt tttcgagtaa aaataaatca tttttgctat gggcaagttt tatgcttata        60
     tattttacta acatatcaat atacgtaagc aaaatacatc atcatggttt gaataaaaaa       120
     atatataatt taaattttgt gagtaatgta tttaagtata atgcaagaag gagaggtaat       180
     tcattaaatg ttttaatcaa ttctccagca caagtaaaat tatccgaaat ggaagatgct       240
     aaagatagaa gtgggaaata ttgtattata gaaatatgtg ggaaaattag atgggtagaa       300
     gaaggtcggt tttatgatgt atttagaata aaacaagaag aaaatagaaa tatatatttg       360
     aatagaattt tattttatag taatgaagag gggaatatat tttttgggag accattttta       420
     gataatgtta gaattcatgc aaccgtatta aatcatttta gaggacataa aatatatcga       480
     ttgaaatata aaccgaaaaa aaattataaa agattttatg ggcatagaca agaaatgaca       540
     agaattaaaa taaataaaat tgaatataat aatgaattac ttggacagga aaaaagaatt       600
     tataatttct ttaaagatga ttctctatat tatatattaa atcgtataca taatatagta       660
     agaccaagtt tagaattaaa acatttaaaa aaaaatttta tagaatatat taattctttc       720
     tgctctttga aattcgaaac tttttataaa cataaaggta attacaaaaa agaaaaaatg       780
     cttcgtaata ttctaaaaac aaaaaaatta agtaaaagac ctgaagttat tgaagaagtt       840
     aaaaaaatag aagaagaaaa aaagaaacaa cgattaacta aatgtgaccc tctggatgat       900
     tttgatccag ttgtaaatga atttatgata aaagaacatt tctattcata a                951
//

If you have problems or comments...

PBIL Back to PBIL home page