(data stored in SCRATCH zone)

EMBL: AL844507.PE273

AL844507.PE273       Location/Qualifiers
FT   CDS_pept        1198858..1206057
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827800"
FT                   /product="SET domain protein, putative"
FT                   /EC_number="2.1.1.43"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0012:mRNA"
FT                   /db_xref="GOA:Q8IBB0"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB0"
FT                   /protein_id="CAD51097.1"
FT                   /translation="MLNDMNDKKDSIRNRNYKKNKKDEERNIRKYSNDNINVVNNMKDI
FT                   YNNNNNNINKSVIDCGNNLKRIEGKKVFERNKFGQFIKKSNSPSLKDTNIKSNNNKNMK
FT                   NTNHNNEENNNNNNTNNTLSNKEKIKVLIDKMKKIQNKKEVNKTLDKPMYIRNFQDEKK
FT                   VSTHNNAYKLKRNGDPRNYGDIKNGDNIKNGDNNKNGDNIKNGDNIKNGDNIKNGDNIK
FT                   NGDNIKNGDNIKNGDNIKNGDDQIIGCLKNNREPRSNVENETNEMSNSYGKFTKNRDLK
FT                   NSDKIKMNDEYRRNNDANISDYNKKNNNNNVNKSNNVVRSSDESLSSDTINKSDCKNKV
FT                   EENSSRNADESHKKEDGDLINKDKDEKEGENLSVPKESNETYYRISRRERCRNLKKEDN
FT                   LKIINDEDNSVSHFIKEGRKRSVRERSNLRNYNYINVNNNIKDDDFVDEPNNGSSIIKM
FT                   NERKKTILRRGARHRRRNPRKRGRRCSSLRNNRNTINSVTKSNYDMSDGDNYEKGRKFL
FT                   YDNSSNYNELDPLNSKFSNIKISKNFFLKMNDDEDEEDEDGVGDDDKTSKNSSYSFGFN
FT                   ERNIEKKIIILEQKDGIYEINENYLKYDNMKDMEDRKNMEDMKNMEDRKNMEDMKNMEY
FT                   MKNMEYMKNMEYMKNMEDMKNMEDMKNMEDMKNMEDMKNMEDMKNMEDDNKKDYMNDNL
FT                   KDDIVIKDNIVIKDDIVMKDNIVMKDNINDSVKDNINEELENNETSCKSSKLNDVTHNN
FT                   NNICDDNNIVSHSNGEMKEVNIMYPINNEINIKKKRILNNDEILILLNLLRDININRFN
FT                   IKHVMTSKDCMYEKFMLYNLFSYNITCLKSSLKMMYAYCLFKNLKLFYQIQYKNMNMTE
FT                   KSIPNYKIKNNLLDTHCIILSMFENYYENVSKQKMPIADFINSFYLNIHNINIGKKKVQ
FT                   PNKNYENIVLPEKDNRKITSMYTNKSLLYSNYMNKDINMENKAYKLNDINMENYRSDHK
FT                   NNTFIDNDCNNNHKYNNICKNELNSCISNISNDPNNNKNVHTMNKDLYGNIYTEQNAYH
FT                   VHNYKDMRNEHENNNNIKKKDNIENSIYYDNKMYLGANEKTPCLKDIHMNKNYEQTYDN
FT                   YDGTNGYNNNNKKKNDNKKNDNNNNDNNNNDNNNNDNQDDNHHDNNKEEYNNQNHLFLN
FT                   NESRKRKFFTNILPYKNKKKKLPYTINLNNDNKTYHHESINNENHMPLWDYKELENIKN
FT                   MINDEKDEEDCTPLAHSIKITKNYDNINMDECNVRNENQEYKDNVTNYKVCQDGNFECY
FT                   DVNESVLVRDIHMEKNNNVEKNNNDEKKNNDEKKNNDEKKNNDEKKNNDEKKNNDEKKN
FT                   NDEKNNDDNNNIIEKAKENIESIPYDKNCSQDNIQYNMAYKDTSLLLCEQRDMDKGNKK
FT                   EDDTIKMEDIHFSADMECSPMLKYRKRNYDNKNDDDYVKNDDDYVKDDDGCVKNDDGCI
FT                   KNDDGYIKNDDGYIKNDDGYIKNDDDYNNNGEYLHGSDNNLSAHKYNSVCRRRRRVDRN
FT                   KESNEKEKRVYRNDIMELENVDVMLLERIKKNYKMLIRNDNENKKKKKKNNGTVTILED
FT                   VDNVYDDNNNNNNDNNIDNNNNNNNNNNNNNNNNNVESHNNNNNERGSTKIEKCRKNKI
FT                   TFFNKYSKLLNNDNVDKKKSKYMLTTESLYNNNFNILDIKVNTHFAHNYHISLFFFCKY
FT                   TSYNLYLHPLNKNEHIVSYVILNSKNEVLTDNGNSFVLRYLLSFLTNKISSLRKCYANA
FT                   LYNSYLLQIPIRIFRHHNLENKYSPQYGIRYDGIYKIINAFTINDYSTPEYKRDILYVF
FT                   KRLYVDKCFIPNMNPKILDKQDKAERKKNFIEKNSVSINVMMNKEIIMTLRIPYLKNYK
FT                   STTFTNFNHIYKFIKKKCIQKKKAMPWIQSEVSIYEACMQHIKKTEEKKKEHFLNSQKM
FT                   NNIKTKVNNTNDIYNNENLNSGDDAFKDCIQAINVDKSVQQINDVRFDMNDGNYKMGDI
FT                   KKECSNVYENMFPAKNNNKIDINKININSNHFSNSSNNNNCDNYKRLGEPNFPYWCLGK
FT                   YLPFVLVLETLNFEKEIDIYKGIRTKNLKNLKISIIKTEIPINCEMAKRPAHLFIPIKS
FT                   KEAISAYIELKKPYDNHWNPYEDLSGGKEIFKIPVENVVDESLPPMNFTYVNKTIFFSR
FT                   LPPYNLLPLCSGCAPHNYNKKEYVDLYINGYCKGIRHKKTNRIYCDGNKNYDINDFNVL
FT                   AACSGNCLCDPLKCTNKFPEGLHYPIKVVKTKDIGWDIVSCSFIKANSLIMHYVGEITT
FT                   RKEMISREHEYDKKGYFNYFIETAEVDETYPDDWKIPCIDALFISNVARFLNHSCEPNV
FT                   NVITIWRGDNYPSVGIFASRDIQPNEPLKYHYGINYKNIKCMCASKKCKGYIG"
     atgttgaatg atatgaatga taaaaaagat agtattagaa acagaaatta taaaaaaaac        60
     aaaaaagatg aagaaagaaa tataagaaaa tattcaaatg ataacattaa tgttgtaaac       120
     aatatgaaag acatttataa taataataat aataatatta ataaaagtgt tatagattgt       180
     ggtaataatt taaaaagaat tgaagggaaa aaagtatttg aaagaaataa atttggtcaa       240
     tttataaaga aatcaaattc tccatcttta aaagacacca atataaaaag taataataat       300
     aaaaatatga aaaatactaa tcataataat gaggaaaata ataataataa taatactaat       360
     aatactttaa gtaataaaga aaaaataaaa gttcttatcg ataaaatgaa aaaaatacaa       420
     aataaaaaag aagttaataa aacgttagat aaacctatgt atatacgaaa ttttcaggac       480
     gaaaaaaaag tttctactca taataatgct tacaaattaa aaagaaatgg ggaccccaga       540
     aattatggag atataaaaaa tggtgataat atcaaaaatg gtgataataa caaaaatggt       600
     gataatatca aaaatggtga taacataaaa aatggtgata atatcaaaaa tggtgacaat       660
     atcaaaaatg gtgacaatat caaaaatggt gataatatca aaaatggtga taatatcaaa       720
     aatggtgatg accaaattat tggatgtctt aaaaataata gggaaccgag aagtaatgtg       780
     gaaaatgaaa ctaatgaaat gtccaatagt tatgggaagt ttacaaagaa tagggatttg       840
     aaaaatagtg acaagattaa aatgaatgat gaatatagaa gaaataacga tgctaatatt       900
     agtgattaca ataaaaaaaa taataataat aatgtgaaca aaagtaataa tgtggtgaga       960
     agtagcgacg agtctctaag cagtgatact ataaataaat ccgattgtaa gaataaggtt      1020
     gaggagaata gttcacgtaa tgccgatgag agtcataaga aggaagatgg ggatttaata      1080
     aataaggata aagatgagaa ggaaggagaa aatttaagtg tacctaagga aagtaatgag      1140
     acttattata gaattagtcg aagggagagg tgtcgtaatt taaagaaaga agataattta      1200
     aaaattataa atgatgaaga taatagtgta agtcacttta taaaagaagg acggaaaaga      1260
     agtgtacgag aaagaagtaa tttaagaaat tataattata taaatgtaaa taataatata      1320
     aaggatgacg attttgtgga tgagcctaat aatggtagta gtataataaa aatgaatgaa      1380
     aggaaaaaaa cgattttaag aagaggtgca agacatagaa gaaggaaccc aagaaaaaga      1440
     ggaaggagat gttctagctt aagaaataat agaaatacta taaattctgt gacaaaaagt      1500
     aattatgata tgtccgatgg ggataattat gaaaaaggta gaaaattttt atatgataat      1560
     agtagtaatt ataatgagtt ggatccatta aatagtaaat tctctaatat aaagatttca      1620
     aaaaactttt tccttaaaat gaatgatgac gaagatgaag aagatgaaga tggcgttggt      1680
     gatgatgata agactagtaa aaacagttcg tattcgtttg gatttaacga aagaaatata      1740
     gaaaagaaga taattatatt agagcagaag gatggaatat atgagataaa tgaaaattat      1800
     ttgaagtatg ataatatgaa agatatggaa gataggaaaa atatggaaga tatgaaaaat      1860
     atggaagata ggaaaaatat ggaagatatg aaaaatatgg aatatatgaa aaatatggaa      1920
     tatatgaaaa atatggaata tatgaaaaat atggaagata tgaaaaatat ggaagatatg      1980
     aaaaatatgg aagatatgaa aaatatggaa gatatgaaaa atatggaaga tatgaaaaat      2040
     atggaagatg acaataaaaa agattatatg aatgataatt tgaaagatga tattgttatc      2100
     aaagataata ttgttatcaa agatgatatt gttatgaaag ataatattgt tatgaaagat      2160
     aatattaatg atagtgtaaa ggataatatt aatgaagagc ttgagaataa cgaaacctct      2220
     tgcaagagtt ccaaattaaa tgatgtcact cataataata ataacatatg tgatgataat      2280
     aatattgtta gtcatagtaa tggtgagatg aaagaagtta atattatgta tcctataaat      2340
     aatgagatta atataaaaaa aaagagaata ttaaacaacg atgaaatatt aatattatta      2400
     aatttattaa gagatattaa tataaataga tttaatataa aacatgttat gacaagtaaa      2460
     gattgtatgt atgaaaagtt tatgttatat aatttatttt cttataatat tacatgttta      2520
     aaaagttctt taaaaatgat gtatgcatat tgtttattta aaaatttgaa attgttttat      2580
     caaattcaat ataaaaacat gaatatgaca gaaaaatcca taccaaatta taaaataaaa      2640
     aataatttat tagataccca ttgtattatt ttaagtatgt ttgaaaatta ttatgaaaat      2700
     gtaagtaaac aaaaaatgcc tatcgctgat tttattaatt ccttttattt aaatatacat      2760
     aatataaaca taggtaaaaa gaaagtacaa ccaaataaaa attatgaaaa cattgtgtta      2820
     ccagaaaaag acaacagaaa aataacatca atgtatacaa ataaatctct tctatattct      2880
     aattatatga ataaagatat aaatatggag aacaaagcat acaaacttaa tgatattaat      2940
     atggaaaact atcgtagtga tcataagaat aatacattta tagataatga ttgtaataat      3000
     aatcataaat ataataatat ttgtaaaaac gaattaaact catgtataag taacatatct      3060
     aatgatccaa ataataataa aaatgttcat actatgaata aagatctcta tgggaatata      3120
     tatacagaac aaaatgcata tcatgtacat aattataagg atatgagaaa tgaacatgaa      3180
     aataataata atataaaaaa aaaagataac atagaaaatt ctatatatta tgataataaa      3240
     atgtatctgg gcgctaatga aaaaacgcca tgtttaaaag atatacatat gaataagaat      3300
     tatgaacaga catatgataa ttatgatggt acaaatggat ataataataa taataaaaaa      3360
     aaaaatgata ataaaaaaaa tgataataat aacaatgata ataataacaa tgataataat      3420
     aacaatgata atcaagatga taatcaccat gataataata aggaagaata taataaccaa      3480
     aaccatctct ttttaaataa cgaaagcaga aaaagaaaat tttttacaaa tatattacca      3540
     tataaaaata aaaagaaaaa actcccatac acaataaacc taaataacga taataaaacg      3600
     tatcatcatg aatccataaa taatgaaaat catatgccct tatgggatta caaagaatta      3660
     gaaaatataa aaaatatgat caacgatgaa aaagatgagg aagattgtac gcccttagca      3720
     catagtataa aaattacaaa aaattatgat aatataaata tggatgagtg caacgtaaga      3780
     aatgaaaatc aagaatataa agataatgta actaattata aagtgtgtca agatggtaat      3840
     tttgagtgtt atgatgtcaa cgaatcggtg cttgtgcggg atattcacat ggaaaaaaat      3900
     aataacgtgg aaaaaaataa taatgatgaa aaaaaaaata atgatgaaaa aaaaaataat      3960
     gatgaaaaaa aaaataatga tgaaaaaaaa aataatgatg aaaaaaaaaa taatgatgaa      4020
     aaaaaaaata atgatgaaaa aaataatgat gataataata atatcataga aaaagcaaaa      4080
     gagaatatag aaagtattcc atatgataaa aactgttcac aggataacat acagtataat      4140
     atggcgtata aagatacatc attattatta tgtgagcaga gggacatgga caaggggaat      4200
     aaaaaagaag acgataccat taaaatggaa gatatccatt tttcagccga tatggaatgt      4260
     tcccccatgt taaaatatag gaaaagaaat tatgataata aaaatgacga tgattatgtt      4320
     aaaaatgacg atgattatgt taaagatgac gatggttgtg ttaaaaatga cgatggttgc      4380
     attaaaaatg acgatggtta cattaaaaat gacgatggtt acattaaaaa tgacgatggt      4440
     tacattaaaa atgacgatga ttataataat aatggggagt accttcatgg tagcgacaat      4500
     aaccttagtg cacataagta taacagtgta tgtagacgaa ggagacgggt agatagaaat      4560
     aaggagagca atgaaaaaga gaaacgagtt tatagaaatg atatcatgga acttgaaaat      4620
     gtagatgtga tgcttctaga gcgcataaaa aagaattaca agatgcttat tagaaatgat      4680
     aacgagaata aaaaaaaaaa aaaaaaaaac aatggaacgg taactatatt ggaagatgta      4740
     gataatgtgt atgatgataa taataataat aataatgata ataatattga taataataat      4800
     aacaataata ataacaacaa taataataat aacaataata atgttgaaag tcataacaat      4860
     aataataacg aaaggggtag tacgaaaata gaaaagtgtc gtaaaaacaa aataacattt      4920
     tttaataaat atagtaaatt acttaataat gataatgtag ataagaaaaa aagcaaatat      4980
     atgctaacta ccgaatcatt atataataat aattttaata ttttagatat caaagtaaat      5040
     actcattttg cacataatta tcatatatct ttattttttt tttgtaaata tacttcatat      5100
     aatttatatt tacatccatt aaataaaaat gaacatatag tatcttatgt tatcttaaat      5160
     tcaaaaaatg aagttcttac agataatgga aattcttttg ttttaagata tttattgtcc      5220
     ttcttaacaa ataaaatatc tagcttaaga aaatgctatg ctaatgcttt atataattct      5280
     tatttattac aaatacctat acgtatattt agacatcata atttagaaaa taaatatagt      5340
     ccacaatatg gtattagata tgatggtata tataaaatta taaatgcttt tacgataaac      5400
     gattattcaa ctcctgaata taaaagagat atattatatg tatttaaaag attatatgtt      5460
     gacaaatgtt ttataccaaa tatgaatcct aaaattcttg ataagcaaga taaagctgaa      5520
     agaaaaaaaa attttataga aaagaattcc gtttctatta atgttatgat gaataaagaa      5580
     ataatcatga cattacgaat accttattta aaaaattata aatctactac atttacaaat      5640
     tttaatcata tatataaatt tatcaaaaaa aaatgtatcc aaaaaaaaaa agctatgcca      5700
     tggattcaat cggaggtttc tatatatgag gcttgtatgc aacacattaa aaaaactgaa      5760
     gaaaaaaaaa aagaacattt tttgaatagc caaaaaatga ataatataaa aactaaagta      5820
     aataatacaa atgatatata taataatgaa aacctcaata gtggtgatga tgcatttaag      5880
     gattgtatac aagccataaa tgttgacaag tctgtacaac aaattaatga cgttcgtttt      5940
     gatatgaatg atgggaatta taaaatgggg gatattaaaa aggagtgttc taatgtttat      6000
     gaaaatatgt ttcctgctaa aaataataat aaaatcgata ttaataaaat taatattaat      6060
     agtaaccatt ttagtaatag tagtaataat aataattgtg ataattataa aagattggga      6120
     gaacctaatt ttccatattg gtgcctaggg aaatatttac catttgtttt agttcttgaa      6180
     acgttaaatt ttgaaaaaga aattgatata tataaaggta taagaactaa aaatttgaag      6240
     aacctgaaga tatctataat aaaaaccgaa atccccataa attgtgagat ggctaaaaga      6300
     ccagctcatt tatttatacc tataaaaagt aaagaagcaa tatcagctta tatagaatta      6360
     aaaaagccat atgataatca ttggaatcca tatgaagatt tatctggtgg taaagagatt      6420
     tttaagattc ccgttgaaaa tgttgtagat gaatcattac ctcctatgaa ttttacttat      6480
     gttaataaga ccatattttt ttcacgcttg cctccttata atttattgcc cttatgttct      6540
     ggttgtgctc ctcataatta taataaaaag gaatatgtag atctttatat taatggatat      6600
     tgtaaaggta tacgacataa aaaaacaaat agaatatatt gtgatggaaa taaaaattat      6660
     gatattaatg attttaatgt cttagctgct tgttctggta attgtttatg tgatccttta      6720
     aaatgtacaa ataaatttcc cgaaggatta cattatccta taaaagttgt aaagacaaaa      6780
     gatattggat gggatatagt ttcttgttca tttattaagg ctaattcatt aattatgcat      6840
     tatgtaggag aaataacaac aagaaaagaa atgatatcta gagaacatga atatgataaa      6900
     aaaggttatt ttaattattt tattgaaaca gctgaagtcg atgaaacata tccagatgat      6960
     tggaaaatac catgtattga tgctctattt atatctaatg ttgctcggtt cttaaatcat      7020
     tcttgtgaac ctaatgttaa tgtaattact atatggagag gtgataatta tccatccgtc      7080
     ggtatatttg catcaagaga tatacaacca aatgaacctt taaaatatca ctatggaatt      7140
     aattataaaa atattaagtg catgtgtgca tctaagaagt gtaaaggtta cataggttga      7200
//

If you have problems or comments...

PBIL Back to PBIL home page