(data stored in ACNUC9543 zone)

EMBL: AL844507.PE274

AL844507.PE274       Location/Qualifiers
FT   CDS_pept        complement(join(1206788..1208063,1208219..1208394))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827900"
FT                   /product="protein disulfide isomerase"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827900"
FT                   /db_xref="GOA:C0H4Y6"
FT                   /db_xref="InterPro:IPR005788"
FT                   /db_xref="InterPro:IPR005792"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Y6"
FT                   /protein_id="CAX64161.1"
FT                   /translation="MNRKYFSSLFLFLISFVFESFVRSHGDLFNHFVTDIHDGELDKFI
FT                   TKNDIVLVMFYAPWCGHCKRLIPEYNEAANMLNEKKSEIKLVSIDATSENALAQEYGIT
FT                   GYPTLILFNKKNKINYGGGRTAQSIVDWLLQMTGPVFSHVEGNIEDVLKEKKINVAFYL
FT                   EYTSEDNDLYKKFNEVGDKNREIAKYFVKKNDKHNKLFCFRTDEKKVEYDEKTPLEEFV
FT                   TSESFPLFGEINTENYRFYAESPKELVWVCATYEQYNEIKEHVRLAAQELRKKTHFVLL
FT                   NIPEYAEHAKASLGLTEFPGLAFQSNEGRYLLKNPKESLLNHNAIINFFKDVEAGKIEK
FT                   SLKSEPIPEDDKNAPVKIVVGNSFVDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEDLGR
FT                   KLKKYDSIIVAKMDGTLNETPIKDFEWSGFPTIFFVKAGSKIPLPYEGERSLKGFVDFL
FT                   NKHATNTPISIDGVPEFEDGTSEEL"
     atgaacagaa agtatttttc ttcccttttt ttatttctta tttcttttgt gttcgaatca        60
     tttgttcgtt cgcatggtga cctttttaat cattttgtaa ctgatataca tgatggggaa       120
     cttgataaat tcataacaaa gaatgatata gttttggtta tgttttacgc tccatggtgc       180
     ggtcattgta aaaggctaat cccagaatat aatgaagctg caaatatgtt gaatgagaaa       240
     aagagcgaaa taaaattagt aagtattgat gctacttcag aaaatgctct tgctcaagaa       300
     tatggaataa caggatatcc aactttgatt ttatttaata aaaagaacaa aataaattat       360
     ggaggcggga gaacagctca atctattgtt gattggttat tacaaatgac aggtcccgta       420
     tttagtcatg ttgaagggaa tattgaagat gtcttaaaag agaagaaaat caatgtggct       480
     ttttatttag aatatacttc agaagataat gatttataca aaaaatttaa tgaggttggg       540
     gataaaaata gagaaattgc aaaatatttc gtaaagaaaa atgataaaca taataaatta       600
     ttttgtttta gaacagatga aaaaaaagtg gaatatgatg aaaagacacc gctcgaagaa       660
     tttgttacat ctgaatcatt tccattattt ggagaaatta atacagaaaa ttatagattc       720
     tatgctgaaa gcccaaaaga attagtatgg gtatgtgcta cctatgaaca atataacgaa       780
     attaaagaac atgtaagatt agctgcacaa gaattaagaa aaaaaactca tttcgttctc       840
     ttaaatatac cagaatatgc tgaacatgct aaagcatcat taggattaac agaattccca       900
     ggattagctt tccaatcaaa tgaaggaaga tatttattaa agaacccaaa agaatcttta       960
     ttaaaccaca atgctattat caatttcttt aaagatgtag aagctggaaa aatcgaaaaa      1020
     tctcttaaat cagaacccat accagaagat gataaaaatg cacccgtcaa aatagttgtt      1080
     ggtaactctt ttgtagatgt tgtcttgaaa agtgggaaag atgtactcat tgaaatatat      1140
     gcaccatggt gtggtcactg taaaaaatta gaacccgttt atgaagactt aggaagaaaa      1200
     ttaaaaaaat atgattccat tattgtagcc aaaatggatg gtacattaaa tgaaacccca      1260
     ataaaagatt tcgaatggtc tggattccca accatcttct ttgtcaaggc tggttccaaa      1320
     atacctttgc catatgaagg agagagatca cttaaaggtt ttgtagattt cttgaataaa      1380
     cacgcaacca acacgccaat atcaatagac ggggtacctg aatttgaaga cggcacatcc      1440
     gaggagttat aa                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page