(data stored in ACNUC9543 zone)

EMBL: AL844507.PE278

AL844507.PE278       Location/Qualifiers
FT   CDS_pept        complement(1221025..1222683)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828300"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0010:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB4"
FT                   /protein_id="CAD51092.1"
FT                   /translation="MEDQDNMNDSYYKNKEYEQENENFNINNEDEKKEENSFHQVTNVY
FT                   HSNVYINKNTKEDNIIRKYLSEQMTKVNIINNNHNIDDNNNNNNNNNELYINQVTNIDD
FT                   SDDDVPLLKTYGINHTINTKYEKNDNPFNNNNEEEEEKEKEKEKEHQPHQGNQINNDNN
FT                   SNQEKHGIFLSKQESSKLHTKYANQDNQKETSSSDTSSDDDVCLLNLIKNDKNYNINNF
FT                   NNQNYYEKKNNFKDDDNNNSSDYSSYDSDEPILIRSNLKNKINIQTNKLGNTSHYSNTC
FT                   MNNNNRYQTNKTKLINKKTTLKSSENKKDNKFKNINAKTSLSKISCRKTSKNSNDISKR
FT                   KKKTITKTKKKTKKQKKKQKKTKTKIKNKNKTNKHKDNKGNNHFNDNENDSICIGTFDP
FT                   RNRSNKEKLVAQLLIRWWYVLPDWPPPDYDYKDELYNRKLKLVPLEEYEDKEDIDSQGF
FT                   RKVYQISAFPGIFRDAMGIAYDLRDKDSCPCYNNLIKKTDQELLQLIYQAIKNQIQCLK
FT                   NSVYNETFMEKNLEKELKEVELKLNKITKKNIIKI"
     atggaagacc aagataacat gaacgattca tactataaaa ataaggaata tgaacaagaa        60
     aatgaaaact tcaatattaa taatgaggat gagaaaaaag aagaaaattc gtttcatcag       120
     gtcaccaatg tatatcatag caatgtgtat ataaataaga atacaaaaga agataatatt       180
     ataagaaaat atttaagtga gcagatgaca aaggtcaaca taataaataa caaccacaat       240
     atagatgata ataataataa taataataat aataatgaac tttatattaa tcaagttaca       300
     aatattgatg atagtgatga tgatgttcct ttattaaaaa catatggaat taatcatact       360
     atcaacacaa aatatgaaaa aaatgacaat ccttttaata ataataatga ggaagaggag       420
     gagaaggaga aggagaagga gaaggaacac cagccgcatc aaggcaacca aataaataat       480
     gataataatt cgaatcaaga gaagcatggt atatttttat ccaaacaaga atcttctaaa       540
     cttcatacaa aatatgctaa tcaagataat caaaaagaaa cgtcttcatc agatacaagc       600
     agcgatgatg atgtatgtct attaaattta ataaaaaatg ataagaatta taatattaat       660
     aattttaata accaaaatta ttatgaaaag aaaaataatt ttaaagatga tgataataat       720
     aattcttcag actactctag ctatgattca gatgaaccaa tactcataag aagtaattta       780
     aaaaataaaa taaatattca aacaaataaa ttaggcaata ctagtcatta tagtaatact       840
     tgtatgaata acaataatag gtatcaaact aataaaacga aattaattaa taagaaaaca       900
     acacttaaaa gtagtgagaa caaaaaagat aacaaattca aaaatataaa tgcaaaaact       960
     agtttatcca aaattagctg tagaaaaaca agcaaaaatt caaatgacat atcaaaaaga      1020
     aaaaaaaaaa caataaccaa aacaaaaaaa aaaacaaaaa aacaaaaaaa aaaacaaaaa      1080
     aaaacaaaaa cgaaaataaa aaataaaaat aaaacaaata aacataaaga taataaagga      1140
     aataaccatt ttaatgataa cgaaaatgat tctatttgta taggtacctt tgatccaaga      1200
     aatagatcga ataaagaaaa attagtagct caattattaa tacgctggtg gtatgttctt      1260
     cccgattggc caccaccaga ttatgattat aaagatgaat tatataatcg aaaattaaaa      1320
     ttggtcccat tagaagaata tgaagataaa gaagatatag atagtcaagg atttaggaag      1380
     gtttatcaaa tatcggcttt cccaggtatt tttagagatg ccatgggtat agcatacgac      1440
     ctaagagata aagactcatg tccatgttat aataatttaa taaaaaaaac agatcaagaa      1500
     ttattacaat taatatatca agctattaaa aatcaaatac aatgtttgaa aaattcagtc      1560
     tacaatgaaa catttatgga aaaaaatttg gaaaaagaat taaaagaagt cgaattaaaa      1620
     ttaaataaaa tcacgaaaaa aaacataata aaaatataa                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page