(data stored in ACNUC9543 zone)

EMBL: AL844507.PE279

AL844507.PE279       Location/Qualifiers
FT   CDS_pept        complement(1224094..1225863)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828400"
FT                   /product="mitochondrial inner membrane protein OXA1,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.14:mRNA"
FT                   /db_xref="GOA:Q8IBB5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB5"
FT                   /protein_id="CAD51091.1"
FT                   /translation="MFQQNNSLKCNFNIIFHHISFRTNKGEWTKGLSTNPNKINQIENN
FT                   KSNINNTYYHIYQYDKSILVNKFIQMYIKMGYIKNKKNKISIKQNNNIYNKHNINNIYN
FT                   KHNINNIYNIYNIYYNTFICSTNNVRNKQSFCNNNVHDKFGGLALFSRFFFTMPINNIN
FT                   NYFNKQHNDKNINDKFDTSHCEEDPDKGVSKNIDHLKREDEHGKALTNKEMNNNNNNNN
FT                   NNDDNIYNDDNVYNDDNNYNDGNIYNNNNDYAYNNKSNEGSTYPLNEEETNVNLTEDIY
FT                   PYTDFIIEKCKLNIKSDVDIYENTWYVKLIYDLLNSTKLFFDCTWMSSIIMTTLFMRII
FT                   ILPLTISSERDRRKQKILSPLLKELTKKLKDNAQDGNIKKAVEFKKKILNIRNTHGISL
FT                   IPKSIILMAFFQTPLFFIFYFSMKRIASYPDIFKDFTFESPLWLDSLSLPDPYYILPIL
FT                   SSLLLLSNNELTLLIDKKINENNKQSNLNNQEETEFQKNMKKITKLAMRLFYLSSVLFF
FT                   KSMPSGLFIYFITNTFFQLFITQICKIKIIENFLDLPPLHSKGFITSTNTSQQQTTSQK
FT                   KIIHMNDLIKRKK"
     atgtttcaac aaaataattc cctcaaatgt aattttaata taatttttca tcatatttct        60
     ttcagaacaa ataaaggaga atggacaaag gggttgagta ccaacccaaa taaaataaat       120
     caaatagaaa ataacaaaag taatataaat aatacatatt atcatatata tcaatatgac       180
     aaaagtatac ttgttaataa attcatacaa atgtatataa aaatggggta cataaagaat       240
     aagaaaaata aaataagtat aaaacaaaac aataatatat ataacaaaca taacataaat       300
     aatatatata acaaacataa cataaataat atatataata tatataatat atattataat       360
     acatttatat gtagtacaaa taatgtaaga aataaacaat cattttgtaa taataatgta       420
     catgataaat ttggtgggct tgctctattc tcgagatttt ttttcactat gcccataaac       480
     aatataaata attattttaa caaacaacat aatgataaaa acataaatga caagtttgat       540
     acttcccact gtgaggaaga tcctgataag ggggtatcta agaacattga tcatctcaaa       600
     agagaagatg aacatgggaa agccttaacc aataaggaaa tgaataataa taataataat       660
     aataataata atgatgataa tatttataat gatgataatg tttataatga tgataataat       720
     tataatgatg gtaatattta taataataat aatgattatg cttataataa caagagtaat       780
     gaaggaagca catacccttt aaatgaagaa gaaactaacg taaatctaac agaagatata       840
     tatccatata cagatttcat tattgaaaaa tgtaaactta atataaaaag tgatgtagat       900
     atatatgaaa acacttggta tgtgaaatta atatatgatt tattaaattc cacaaaatta       960
     ttttttgatt gtacatggat gagttcaatt ataatgacaa cattatttat gagaatcata      1020
     attttgcctt taaccatatc ttcagaaaga gatagaagga aacaaaaaat attaagtcct      1080
     ttattaaaag aattaacaaa gaaattaaaa gataatgcac aagatggaaa tattaaaaaa      1140
     gctgtagaat ttaaaaaaaa aattttaaat ataagaaata cacatggtat atcattaata      1200
     ccgaaatcta ttattttaat ggctttcttt caaacacctt tattttttat attctatttt      1260
     tctatgaaaa gaatagcatc ttatcctgat atttttaaag actttacttt tgaatcccca      1320
     ttgtggttag atagtctatc cttaccagac ccatattaca ttcttcctat cttatcatca      1380
     ctcttgttat tatcaaataa tgaattaaca ttattaatag ataaaaaaat caatgaaaat      1440
     aataaacaat caaatttaaa taaccaagaa gaaacagagt ttcaaaaaaa tatgaaaaaa      1500
     attacaaaac ttgctatgcg cttattctat ttatcctctg tacttttctt taaatccatg      1560
     ccatctggac tttttatata ttttattaca aatacatttt ttcaattatt cataacacaa      1620
     atatgtaaaa ttaaaattat agaaaatttc cttgacctac cacccttaca ttcgaaggga      1680
     tttataacga gtactaacac atcacaacag caaacaactt cacaaaaaaa aataatacac      1740
     atgaatgatt taatcaaaag gaaaaaataa                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page