(data stored in ACNUC9543 zone)

EMBL: AL844507.PE280

AL844507.PE280       Location/Qualifiers
FT   CDS_pept        complement(join(1226750..1227436,1227738..1227951,
FT                   1228089..1228164,1228358..1228409))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828500"
FT                   /product="translation initiation factor eIF-2B subunit
FT                   alpha, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0009:mRNA"
FT                   /db_xref="GOA:Q8IBB6"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042528"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB6"
FT                   /protein_id="CAD51090.1"
FT                   /translation="MECYDNTKQKDLQEEHDVVRNFRRYYFQEKEEMHIAAIKSISDVL
FT                   KNSISETNFELFINMNEAKCKLNNFINNNQTQQDIISVPHSKRMTIYPIISSCDIYHHF
FT                   VVKKYTHNENNFHVLKNVIENNADEFSASLQKSLETIGSSSNIMFLNKHTTILTHSNSD
FT                   CVKSLIMDVVKNQNKQVSIYFTCTSQVNLNYEEKEKKFDENFLEELNKENINITKIDLT
FT                   QVKDIINKIDFVLIGSEIVTDNGGIINKKGIKLISELCLLYKKPFYVTCQAYKFLKIDK
FT                   NKCSKDFYTFCTQTVTNNFNNIYEFVSPDFITLFYTDIGIFPPSNISYELSKLYINDAF
FT                   YF"
     atggaatgtt acgataacac gaaacagaag gatttacaag aagagcacga tgtggtacgt        60
     aatttcagaa gatattattt tcaggaaaaa gaagaaatgc atatagcagc cataaaatca       120
     atatccgatg tcttaaaaaa tagcatatcg gaaacgaact ttgaattatt tattaatatg       180
     aatgaagcaa aatgtaaatt aaataatttt attaataata atcaaacaca acaagatatt       240
     atatctgtcc cacattccaa aagaatgact atatatccaa taatttcctc gtgtgatata       300
     tatcatcatt ttgttgtaaa aaaatacaca cacaacgaaa ataacttcca tgtacttaaa       360
     aatgttatcg aaaataacgc ggatgaattc tcagcaagcc tacaaaaaag tcttgaaact       420
     atcggaagta gtagcaatat tatgttcctt aataaacata ctactatact aacacacagt       480
     aactcagatt gtgttaaatc tctaatcatg gatgttgtta aaaatcaaaa taaacaagtg       540
     tccatttatt ttacctgcac aagtcaggta aatttaaatt atgaagaaaa agaaaagaaa       600
     tttgatgaga attttttaga agaattaaat aaggaaaata taaatataac aaagatagat       660
     ttaacacaag taaaagatat aataaataaa atagatttcg ttttgatagg atcagaaata       720
     gttacagata atggaggaat aataaataaa aagggtatca aattaatatc tgaattatgt       780
     ttattatata aaaaaccatt ttatgtaaca tgtcaagcat ataagttttt aaaaattgat       840
     aaaaataaat gttcaaaaga tttttacaca ttttgtacac aaacagtaac aaataatttt       900
     aataatatat atgaatttgt atctccagat tttattacac ttttctatac cgatataggt       960
     atattcccac cttctaatat atcttatgaa cttagtaaat tgtatataaa tgacgccttt      1020
     tatttctaa                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page