(data stored in ACNUC9543 zone)

EMBL: AL844507.PE282

AL844507.PE282       Location/Qualifiers
FT   CDS_pept        1233372..1236473
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828700"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.12:mRNA"
FT                   /db_xref="GOA:Q8IBB8"
FT                   /db_xref="InterPro:IPR033290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IBB8"
FT                   /protein_id="CAD51088.1"
FT                   /translation="MSEESFDDTNKAFENEKDIILEKIVKDENNLNNCSNMINMDDVEN
FT                   MKKELYVLHKKDEEIENNVDCFSGDKYNVENVINLKKKKKKDEDTDSSYYKTTLDEVYD
FT                   TSDISTDEMLSNYSSSEDNNNIEMNIINDFYLKDDNTYCLEWNSDIINVLSEEIKEKEK
FT                   LLEDENKDICNMKSRFLKLEKYVNIKKKKIINIKKNIEEKRKIEFDEKEIFKCLQIKND
FT                   FLKKENKKIELEREKNNKKIIETQNNITTCQKNIDDIKKELILKENELNDFINKIKIIQ
FT                   QEEYEIEKIKLSKDKEIQNVSYNLEKYNNEKIQQDKKYEQVKMNNMKFDIELKSIIQEY
FT                   YDIKKDIKNISNKYICIMDMIKCRDKTIYKFEKDYTKTIHKEKQLQNKCLHKQNLINTQ
FT                   KDKNIILNNQIKKIQFDINKIRKELNDKQMSYDKTIIDRDHLNKEYEYEIVEIKEKLQE
FT                   EKKSLENTLQHLNETYITMSTNYEESKNEYEKEQVNNIEKNDLIKSSEQILVQLQNKLQ
FT                   KLLDEIKSLDLEKFQLTQTLQVIKNDYITLEADVLGTQIKIKQIKSNIKKTEKELERQK
FT                   EMLYKFDFQTQVLTKKINMISGISTFEKKKENQKKIILLEKELYKNEDIYNTLNNEMKR
FT                   INIEIKNIKLYQNELQEQKMNYKNLYEKLQLEIKSLESTINNEIKEKENIMLIELNLKI
FT                   ELDKLKSTFSKHVDNLNICKKEKKENMNNAKLSEQDINAHMESLKVIIKNINDEIHKLN
FT                   IQLYEKKNKSNNLQLKLNSIIICNQKNKDQKDICPNENQHIYYKMKIDQDIINLKEQLK
FT                   KINEQIDKENIETKNFQRTLDDIIQTNKEFNDNIKSIDPQYKILLKKKNKLNKKWEQIN
FT                   DHINNLETNINDYNKKIKEGDSQLNNIQLQCENIEQKINKIKESNLKVENNINDLFIKI
FT                   ERASNQLKKNLAPTTNMMKLKNKQIKDDENNLSNNNNNNNNNNNNINVNVNVNCEPVPL
FT                   EKHIFKQIQMESLKEKLSLLMECFKNNIDNVIMKEVFNLIETAE"
     atgagtgaag aaagttttga cgatacaaat aaagcatttg aaaatgagaa agatataatt        60
     ctggaaaaaa tagtaaaaga cgaaaacaat ttaaataatt gtagtaatat gattaatatg       120
     gatgatgtag aaaatatgaa gaaagaatta tatgtgctac ataaaaaaga tgaagaaatc       180
     gaaaataatg tggattgttt ttctggtgat aaatataatg tagagaatgt aataaattta       240
     aaaaaaaaaa aaaaaaagga tgaggataca gattcttcat actataaaac aacattagat       300
     gaagtatatg atacgagcga tatatcgaca gatgaaatgt tgagtaatta tagtagtagt       360
     gaagataata ataatataga gatgaatata ataaatgatt tttatttaaa ggatgataat       420
     acatattgcc ttgaatggaa tagcgatatt ataaatgtat tatctgaaga aataaaggaa       480
     aaagaaaaat tactagaaga tgagaataaa gatatatgta atatgaaaag tcgttttttg       540
     aaattagaaa aatatgtaaa tattaagaaa aagaaaataa taaatattaa aaagaatatt       600
     gaagaaaaga gaaaaattga attcgatgaa aaagagatat ttaaatgctt acaaattaaa       660
     aatgattttt taaaaaaaga aaataaaaaa atagaattgg aaagagaaaa aaataataag       720
     aaaattattg agacacaaaa taatataaca acatgtcaga aaaatataga tgatattaaa       780
     aaagaactaa ttttgaaaga aaacgaattg aatgatttca taaataaaat caaaattatt       840
     caacaagaag aatatgaaat agaaaaaata aaattatcca aagataaaga aatacaaaat       900
     gtatcatata atttagaaaa atataataac gaaaaaatcc aacaagacaa aaaatatgaa       960
     caagtgaaaa tgaataatat gaaatttgat atagaactta aatcaataat acaagaatat      1020
     tatgatataa aaaaagacat aaaaaatatt tcaaataaat atatttgtat tatggatatg      1080
     atcaaatgta gagataaaac tatatataaa tttgaaaagg attatacaaa aacaatacat      1140
     aaagaaaaac aattacaaaa taaatgtcta cataaacaaa atcttattaa tacacaaaaa      1200
     gataaaaata tcattttaaa taatcaaatt aaaaaaatac aatttgatat aaataaaatt      1260
     agaaaagaat taaacgataa acaaatgtca tatgataaaa ctattataga tagagatcat      1320
     ttaaataaag aatatgaata tgaaatagta gaaatcaaag aaaaattaca agaagaaaaa      1380
     aaaagcttag aaaacacatt acaacattta aatgaaacat atataacaat gtctactaat      1440
     tatgaagaat caaaaaatga atatgaaaaa gaacaagtaa ataatatcga aaaaaatgat      1500
     ttaataaaat ctagtgaaca aattcttgtt caactacaaa ataaattaca aaaattgtta      1560
     gatgaaatta aaagtctaga tctagaaaaa ttccaactaa ctcaaacttt acaagtaatt      1620
     aaaaatgatt atataacatt agaagcagat gttttaggca cacaaatcaa aattaaacaa      1680
     ataaagagta atattaaaaa aacagaaaaa gaattagaaa gacaaaaaga aatgttatac      1740
     aaatttgact tccaaacaca agttttaaca aaaaaaataa acatgatctc aggtatcagc      1800
     acatttgaaa aaaaaaaaga aaaccaaaaa aaaatcatat tattagaaaa agaattatac      1860
     aaaaatgaag atatatataa tacattaaat aatgaaatga aaagaattaa tatagaaata      1920
     aaaaatatta aattatatca aaatgaattg caagaacaaa aaatgaatta taaaaattta      1980
     tatgaaaaat tacaattgga aattaaatcg ttggaaagta caataaataa tgaaataaaa      2040
     gaaaaagaaa atattatgct tattgaatta aatttaaaaa ttgaattaga taaattaaaa      2100
     tcgacttttt caaaacatgt agataattta aatatatgta aaaaagaaaa aaaagaaaat      2160
     atgaataatg ccaaattatc tgaacaagat attaatgcac atatggaatc tttaaaagtt      2220
     atcataaaaa atattaatga tgaaatacat aaattaaata tacaacttta tgaaaaaaaa      2280
     aataaatcta ataatctaca actaaaatta aatagtataa tcatatgtaa ccaaaaaaat      2340
     aaggatcaaa aagatatctg tcctaatgaa aatcaacata tatattataa aatgaaaatt      2400
     gatcaagata ttattaattt aaaagaacaa ttaaaaaaaa ttaatgaaca aatagacaaa      2460
     gaaaatatcg aaactaaaaa ctttcagaga accttagatg atatcataca aacaaataaa      2520
     gaattcaatg ataatattaa atctatagat cctcaatata aaatattatt aaaaaaaaaa      2580
     aataaattaa ataaaaaatg ggaacaaata aatgaccata taaataatct agaaacaaat      2640
     ataaacgatt ataataaaaa aataaaagaa ggagattctc aactcaacaa catacaatta      2700
     cagtgtgaaa atatagaaca aaaaattaat aaaattaaag aaagtaattt aaaggtagaa      2760
     aataatataa atgatttatt tattaaaatt gaaagggcat ctaatcaatt gaaaaaaaat      2820
     ttagcaccta ctaccaatat gatgaaatta aaaaataagc aaataaaaga cgatgaaaat      2880
     aatctatcaa acaataacaa caacaacaat aataataata ataatattaa tgttaatgtt      2940
     aatgttaatt gtgagccagt tcctttggaa aaacatattt ttaagcaaat acaaatggaa      3000
     tcattaaaag aaaaattatc tctacttatg gaatgcttta aaaacaatat tgataatgtt      3060
     attatgaagg aagtatttaa ccttatagaa acagcagaat ag                         3102
//

If you have problems or comments...

PBIL Back to PBIL home page