(data stored in ACNUC9543 zone)

EMBL: AL844507.PE283

AL844507.PE283       Location/Qualifiers
FT   CDS_pept        complement(1237285..1239501)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828800"
FT                   /product="GPI-anchored micronemal antigen"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0008:mRNA"
FT                   /db_xref="GOA:Q8IBB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB9"
FT                   /protein_id="CAD51087.1"
FT                   /translation="MKYYTSLYVALIIALCQAVSALIRNSNTPQAFLIPELNNNEKNEF
FT                   NNNEKNEMNNNLNNEFNNNEENCDIQKIAEEMMENLLNENDMYTNIMLSLQNRLSDDYL
FT                   CSEPKYENICIHEKDKISLSFPCSNPKYEKLIHKFTFKKLCNSKAAFNNTLLKSFIEED
FT                   EEQNTFSLMLKQFKILLTCVDDELKDIYKESIDLLVDLKTSITELTQKLWSGKMVNVLK
FT                   KREFLITGILCELRNGNKSPLISKSLEFENLGILKMNNEELLNEAYNAFSDYYYFFPYF
FT                   IQKLLEKGGMIERLIKIHENLTKYRTKDMVNKINAQSKGEVLNNEDILNKLNAYKHYTK
FT                   HGATSFIQSREVKIVNQNVNNDDTTKNQQQNVNNNEKLNNNNNNNNNQQVNNNNNNNNQ
FT                   QVNNNNNNNNNQVNNNNNNNNNQVNNNNYNNNNQVNNNNNNNQQVNNNNNYNNQLNNNN
FT                   FNNNLQVNKNDKHVPKNNHTTATHTNNILYNPLYSINPEKPKDIIKLLKDLIKYLHIVK
FT                   FENNEPTTNIDEEGIRKLLENSFFDLNDDILIVRLLLKPQTVILTVIQSFMLMTPSPSR
FT                   DAKAYCKKALINDQLVPTNDTNILSEENELVNNFSTKYVLIYEKMKLQELKEMEESKLK
FT                   MKYSKTNLSALQVTNPQNNKDKNDASNKNNNPNNSSTPLIAVVTDLSGEKTEDIINNNV
FT                   DIATLSVGVQNTFQGPNAKAGSLINHLSYATFLFFSFILINLLN"
     atgaaatatt atacatcttt gtacgttgca cttataatag ccttatgtca ggcggtaagt        60
     gcccttataa gaaattcgaa cactcctcag gccttcttaa tacctgaatt gaataataat       120
     gaaaaaaacg aatttaataa taatgaaaaa aacgaaatga ataataattt aaataacgaa       180
     tttaataata atgaagaaaa ttgtgatata caaaaaatag cagaagaaat gatggagaat       240
     ttattgaatg aaaatgatat gtatactaat ataatgttat cattacaaaa tagattaagt       300
     gatgattatt tatgctcaga gccaaaatat gagaatatat gtatacatga aaaagataaa       360
     atttctttat cctttccttg ttcaaatcct aaatatgaaa aattaataca taaattcaca       420
     tttaaaaaat tatgtaactc caaagcagct tttaataata ctttacttaa atcttttatt       480
     gaggaagatg aagaacaaaa tacatttagt cttatgttaa aacaatttaa aatattatta       540
     acatgtgtgg atgacgaatt aaaagatata tataaagaat ctattgattt attagtcgat       600
     ttaaaaacat ccattactga attaacacaa aaattatggt caggtaaaat ggttaatgtt       660
     ttaaaaaaaa gagaattctt aataactggt attttgtgtg aattaaggaa tggtaataag       720
     tcaccactta ttagtaaaag tttagaattt gaaaatctgg gaatattaaa aatgaataat       780
     gaagaattat taaatgaagc ttataatgcc ttttcagatt attattattt ttttccatat       840
     tttattcaaa aattattaga aaagggtgga atgatagaaa ggttaattaa aattcatgaa       900
     aacttgacta aatatagaac aaaagatatg gtaaataaaa ttaatgcaca atcaaaagga       960
     gaagtattaa ataatgaaga tatacttaat aaactaaatg catataagca ttatacaaag      1020
     catggtgcaa cttcatttat ccaatctagg gaagtaaaaa ttgtgaacca aaacgtaaac      1080
     aatgacgaca ccacaaaaaa tcagcaacaa aatgttaata ataatgaaaa attaaataat      1140
     aataataata ataataataa tcaacaagta aataataata ataataataa taatcaacaa      1200
     gtaaataata ataataataa taataataac caagtaaata ataataataa taataataat      1260
     aaccaagtaa ataacaataa ttataataat aataaccaag taaataacaa taataataat      1320
     aaccaacaag taaataataa taataattat aataaccaac taaataacaa taattttaat      1380
     aataacctac aggtaaataa aaacgataaa catgtaccaa aaaacaacca cacaactgca      1440
     acacacacaa ataatatttt gtacaatcct ttatattcca tcaatccaga aaaaccaaag      1500
     gatattataa aattattaaa agatttaata aaatatttac atattgttaa atttgaaaat      1560
     aatgaaccta ccacaaacat tgatgaagaa ggaattagaa aacttttgga aaatagtttt      1620
     tttgatttga atgatgatat tcttatagtc cgtttattac taaaaccaca aacagtaata      1680
     ttaacggtca tacaatcctt tatgctaatg accccttccc catcaagaga tgcaaaagct      1740
     tattgtaaga aggcattaat taatgatcaa ttagtaccaa ctaatgatac taatattttg      1800
     tcagaagaaa atgaattagt taataacttc tctacgaaat atgttttgat atatgaaaaa      1860
     atgaaattac aagaattaaa agaaatggaa gaaagcaaat taaaaatgaa atattctaaa      1920
     accaatttat cagctttaca agttacaaat ccacaaaaca ataaagacaa aaatgatgca      1980
     tccaataaaa ataataaccc aaataatagt agtacaccat taattgctgt agtaacagat      2040
     ttatctggtg aaaaaacaga agatataata aataataatg tcgacatagc tacattatca      2100
     gttggggtac aaaatacttt tcaaggacca aatgcaaagg caggaagttt aattaatcac      2160
     ctctcttatg caacattcct ttttttttcg ttcattttaa ttaacttgtt aaattaa         2217
//

If you have problems or comments...

PBIL Back to PBIL home page