(data stored in ACNUC9543 zone)

EMBL: AL844507.PE288

AL844507.PE288       Location/Qualifiers
FT   CDS_pept        join(1256555..1256588,1256680..1256842,1256938..1257016,
FT                   1257122..1257133)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0829300"
FT                   /product="U6 snRNA-associated Sm-like protein LSm8,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0829300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.9:mRNA"
FT                   /db_xref="GOA:C0H4Y9"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034103"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Y9"
FT                   /protein_id="CAX64164.1"
FT                   /translation="MSSINIESYLENEILVITNDSRIFTGKLKGFDQTTNIILGNCHER
FT                   IYKESMEKISLGVYIIRGDTVTLIGEIDEDVDKNILHQKIKPQMLKPIVH"
     atgagttcta taaatattga gtcatactta gaaaatgaaa tattagtaat aacaaatgat        60
     agccgaatat tcacaggaaa attaaaaggc ttcgaccaga cgacaaatat aattttagga       120
     aattgtcatg agcgaatata taaagagtca atggaaaaaa taagtttggg agtgtatata       180
     attagaggag atacagtaac ccttattgga gaaattgacg aagatgttga taaaaatatt       240
     ttgcatcaaa aaattaaacc ccaaatgtta aagccgattg tacactaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page