(data stored in ACNUC9543 zone)

EMBL: AL844507.PE289

AL844507.PE289       Location/Qualifiers
FT   CDS_pept        complement(1257716..1259041)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0829400"
FT                   /product="prolyl 4-hydroxylase subunit alpha, putative"
FT                   /EC_number="1.14.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0829400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.8:mRNA"
FT                   /db_xref="GOA:C0H4Z0"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z0"
FT                   /protein_id="CAX64165.1"
FT                   /translation="MDVKKTIIKCSSPREFTNLDNSKKNEELLKNGKEDFNVHLYDNEI
FT                   KYSDDMQTIINKVINEKNIHFYKKYSSYLLYLSNEKQINDSEGDDSYTNDENTKVFFKI
FT                   QLNPQDMSIIYNIVDKKTIEKILSLCANKYKRSKTSIGYSNEKQEQYKLTNSINRTSST
FT                   VFLYTLRSRSVIEENQIDEDSSIVYTKDENIIELENTICNLVKIPLCYLEPLAIVKYEK
FT                   NNYFNLHHDGSFRRATLLIYLNDVDKDGETIFPCHNLSIKPIQGSGVFWYNNISIDDDY
FT                   AITYCTNKINQITYEEQNNKYHHILDENNNSSVFRTDSAKVYYPSSYSNTQEQPTTYFH
FT                   NSFQDASFIKNNTTTNNTHTNTNETSSQNTNSNHVLKKKKDLIIFLNDKNNLHKYSIDL
FT                   VYDELGNTYIADMTMVHQANRVTEQYKYVINCFFNVNIVRNI"
     atggatgtaa aaaaaacgat aataaaatgc tcgagtccac gagaattcac aaacctggat        60
     aattcgaaaa aaaatgaaga acttttaaaa aatggtaagg aggattttaa tgttcaccta       120
     tatgataacg aaataaaata tagtgatgat atgcagacaa taattaacaa agttataaat       180
     gaaaagaata tacattttta taaaaaatat tcttcttatt tattatatct aagtaatgag       240
     aaacaaataa atgatagtga aggggacgat agttatacaa acgacgaaaa tacaaaagta       300
     ttttttaaaa tacaattaaa tccacaggat atgagtataa tatataatat tgtagataaa       360
     aaaacaatcg aaaaaatatt atccttatgt gcaaataaat ataaaagaag taaaacatct       420
     attggatatt caaatgagaa acaggagcaa tataaattga cgaattcaat caatcgtaca       480
     agttctactg tatttttata tacattaaga agtagatcgg taattgaaga aaatcaaatt       540
     gatgaagata gttctatagt atatacaaaa gatgaaaata taatagaatt agaaaataca       600
     atttgtaatt tggtaaaaat acctttatgt tatttagaac ctttagctat tgtaaaatat       660
     gaaaaaaata attatttcaa tttacatcat gatggatcat ttagaagagc tacactttta       720
     atatatttaa atgatgttga taaagatgga gaaaccatat tcccttgtca taatttatcc       780
     attaaaccaa tacaaggttc tggtgttttc tggtacaata atatatctat agatgatgat       840
     tatgccatta catattgtac taataaaata aatcaaataa catatgaaga gcaaaataat       900
     aaatatcatc atatcttaga tgaaaataat aattcttctg tatttcgtac ggacagtgca       960
     aaagtatatt atccatcatc ttattcaaat acacaagaac aacctacaac ctattttcat      1020
     aattcttttc aagatgcttc cttcataaaa aataatacaa caacaaacaa cacacatacc      1080
     aatacaaatg aaacgtctag tcaaaacaca aactcaaatc atgttcttaa aaaaaaaaaa      1140
     gatctaatca ttttcctaaa tgataaaaat aatttacaca aatattcaat tgacctagtt      1200
     tatgacgaac taggaaatac atacatcgca gatatgacaa tggtacatca agcaaatagg      1260
     gtaactgaac agtacaaata tgttattaat tgttttttta acgtaaatat agttagaaat      1320
     atataa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page