(data stored in ACNUC9543 zone)

EMBL: AL844507.PE293

AL844507.PE293       Location/Qualifiers
FT   CDS_pept        join(1294022..1294193,1294481..1294722)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830400"
FT                   /product="CRA domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830400"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0004:mRNA"
FT                   /db_xref="GOA:Q8IBD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD0"
FT                   /protein_id="CAD51076.1"
FT                   /translation="MKNKLSTLFFITIFLILIFIDSAKGDERKNFWKSRFTAGRGNITN
FT                   KPTEVNHPIKKEGENFLSVGKGDHDESRVMLLKELYQKDNELNIVRKKHKKYKSITVAL
FT                   ASIIGMMLLRNIGSLLYDTVTRLNQKSNRVWML"
     atgaagaata aactttctac attatttttt attacaattt ttcttattct gatttttatt        60
     gattcagcaa aaggagatga aagaaagaat ttctggaaat cgagatttac tgcaggtaga       120
     ggcaatataa caaataagcc aactgaagta aatcacccta ttaaaaaaga aggtgaaaac       180
     tttttgagcg taggtaaagg tgatcacgac gaatcccgtg ttatgctctt aaaagaatta       240
     tatcaaaaag ataatgaatt aaatatagtc cgcaaaaaac ataaaaaata taaatctata       300
     actgttgctt tagcatccat aattggtatg atgttattgc gtaatattgg atcattatta       360
     tatgataccg ttaccagatt aaatcaaaaa agtaaccgcg tatggatgct ttaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page