(data stored in ACNUC9543 zone)

EMBL: AL844507.PE294

AL844507.PE294       Location/Qualifiers
FT   CDS_pept        complement(join(1296134..1297984,1298152..1298328))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830500"
FT                   /product="sporozoite and liver stage tryptophan-rich
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830500"
FT                   /db_xref="GOA:Q8IBD1"
FT                   /db_xref="InterPro:IPR022089"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD1"
FT                   /protein_id="CAD51075.1"
FT                   /translation="MNLEQFKNINKDLATNLFSQLSFLKNENKFLSQGKSLIKFLIGIA
FT                   IFLVVLIFIKSSHPALKEKKKKVLEFFENLVLNKKKKENITAAIASKELADAETTDTSD
FT                   SEDEDHIINKKVKRRKRNIINNPDEKVHNVKEKNSKSKNEEDKTDESYNETSLLSSDEE
FT                   GEVNLEDWKKNEWIKWMDETEEEWQLLKLWLEGEKNKWLEGKNKEYDIWLNHMNSKWTN
FT                   YNKDIDEEYDSNVFKDSYKWNEKQWEQWMKTEGKEFMLQDFKRWLEDSEGYLKSWLIKQ
FT                   WIQWKNMKILECLMNEWRREEDEKWSNLEDTDQIRVLNHKDRKEWLRWKERVTREKLEW
FT                   KHWVEMKENMNIYNKWKKWIKWKKNKLANFNEWSKNFIEKWIREKQWNNWINERKKYTS
FT                   QRKSLEQQFGDNMDKMNKLKKKKILKFFPLFNYKSDLESIMEEDENEYNSFDENEEEND
FT                   EKTGDVNVGKTEALNVAKTEGLNVGKTEDLNVAKTEDLNVAKTADLNAEKTTDLNSEKT
FT                   ADLNSDKTTDLNPEKTTNFNTYKATDLNANKTADLNSDKTTDLNSDKTTNFNTYRTTDL
FT                   NSDKTTNFNTYKTDLYAEKTTDVNLGKTTNHNVAKTTDQKVVKHSLDHEVRQMIDQKVA
FT                   QIMNHDLESTAEQKAEKKGGKAKAKTKVRTVDDDGNEINV"
     atgaatttag agcagtttaa aaatataaac aaagatctgg ctacaaatct tttttctcaa        60
     ctatcatttt taaaaaatga gaataagttt ttgagccagg gtaaatctct tattaaattt       120
     cttatcggaa tagccatatt tctagtcgtt ctcatattta taaaatcgtc tcatccagct       180
     ctcaaagaga agaagaaaaa ggtgctagaa ttttttgaaa accttgtatt gaataagaaa       240
     aaaaaagaga atataacagc agcgatcgca tccaaagaat tggctgatgc tgaaacaaca       300
     gatacaagcg attcagaaga tgaagatcat attattaata aaaaagtgaa aagaagaaaa       360
     aggaatatca taaataatcc tgatgagaaa gtacataacg taaaagaaaa aaatagtaaa       420
     agtaaaaatg aagaagataa aacagatgaa agttacaatg aaactagctt attatcttct       480
     gatgaagaag gtgaggtgaa tttagaggat tggaaaaaaa acgaatggat taaatggatg       540
     gatgaaacag aagaagaatg gcaactttta aaattatggt tggaaggaga aaaaaataaa       600
     tggcttgaag ggaaaaataa ggaatatgat atatggttaa accatatgaa tagtaaatgg       660
     acaaattata ataaagatat agatgaagaa tatgattcaa atgtttttaa agattcttac       720
     aaatggaatg aaaaacaatg ggaacaatgg atgaaaaccg aaggaaaaga attcatgtta       780
     caagatttta aaagatggtt agaagacagt gaaggatatt taaaatcatg gcttatcaaa       840
     caatggatac aatggaaaaa tatgaaaatt ctggaatgtc taatgaatga atggagaaga       900
     gaagaagatg aaaaatggtc aaacctagaa gatacagatc aaatcagagt attaaatcac       960
     aaagatagaa aagaatggct tagatggaaa gaaagagtta ctagagaaaa actcgaatgg      1020
     aaacattggg tagaaatgaa agaaaatatg aatatatata ataagtggaa aaaatggata      1080
     aaatggaaga aaaataaatt agctaatttt aatgaatggt caaaaaattt tatagaaaaa      1140
     tggatacgag aaaaacaatg gaacaattgg attaatgaaa gaaaaaaata tacatctcaa      1200
     agaaaaagtt tagaacaaca atttggagat aatatggata aaatgaacaa attaaaaaaa      1260
     aaaaaaattt tgaaattctt cccactattt aattataaaa gtgatttgga atcaataatg      1320
     gaagaagatg aaaacgaata caacagtttt gatgaaaacg aagaagaaaa cgatgaaaaa      1380
     acaggagatg ttaatgtagg aaagacggaa gctttgaatg tagcaaagac cgaaggtttg      1440
     aatgtaggaa agacggaaga tttgaatgta gcaaagacag aagatttgaa tgtagcaaag      1500
     acggcagatt tgaatgcaga aaaaacaaca gatttgaatt cagaaaaaac agcagatttg      1560
     aattcagaca aaacaacaga tttgaatcca gaaaaaacaa caaattttaa tacatacaaa      1620
     gcaacagatt tgaatgcaaa caaaacagca gatttaaatt cagacaaaac aacagatttg      1680
     aattcagaca aaacaacaaa ttttaataca tacagaacaa cagatttgaa ttcagacaaa      1740
     acaacaaatt ttaatacata caaaacagat ttgtatgcag aaaaaacgac agatgttaat      1800
     ctaggaaaaa caacaaacca taatgtagca aaaacaacag atcaaaaggt agtaaaacat      1860
     tcgttagatc acgaagtaag acaaatgata gaccaaaaag tagcacaaat aatgaaccat      1920
     gacttagaat caacagcaga acaaaaagca gaaaaaaaag gaggaaaagc aaaagcgaag      1980
     acaaaagtaa gaacagttga tgatgacgga aatgaaatta atgtttaa                   2028
//

If you have problems or comments...

PBIL Back to PBIL home page