(data stored in SCRATCH zone)

EMBL: AL844507.PE295

AL844507.PE295       Location/Qualifiers
FT   CDS_pept        join(1303323..1303472,1303593..1304813)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830600"
FT                   /product="Plasmodium exported protein (PHISTc), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.4:mRNA"
FT                   /db_xref="GOA:Q8IBD2"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD2"
FT                   /protein_id="CAD51074.1"
FT                   /translation="MEYLKKTLFISEKNKLWMKKERQYKKYRSRNYIGYRCLIVSLLIF
FT                   YLIIQLSYDNFGENTYNSNDSIIRNRDSRILYEFLSNSYEYDHYNDYVNVEEFNDFSND
FT                   ILEDFSSISNNVNDYGYDNLDENVNLMSFIEVTEVLNDGQNTPPESNVDYVVSELNDDI
FT                   IDEEEDKRLKEAYERILRKRRGISGRHPYHILTSSCNEFNSNNIINEEELDHVELIQNE
FT                   MDSDSYNVLTEEDVQNINSSYNNEELNNNNNNNIRSTSENNVNTYELPNGELHNNSDRL
FT                   NGADVVNMNLYFNGDVYSSLENLEETVETRNEEDEDNEDDEEEFEKMLNELKNNGTLGE
FT                   TCRIWNKLCFIENKKFYNMQMKLWNFCEILAFEYKIPQSTLANEWKKIVTYTNEELIQH
FT                   NLTNISDFNTLVFNKIYDALDFIEFIKHKRESWKQFRESEEPVWKNTLEKNFKNYVQ"
     atggaatatt taaaaaagac tttatttatt tctgagaaaa ataagttatg gatgaaaaaa        60
     gagcgtcagt ataaaaagta ccgttcaagg aattatatag gatatagatg tcttattgta       120
     tctttattaa ttttttactt gataatacag ttgagttatg ataattttgg tgaaaatact       180
     tataatagta atgattcaat tatcaggaat agagatagta gaattttata cgaattttta       240
     tctaattctt atgaatacga tcattataat gattatgtaa atgtagaaga gtttaatgat       300
     ttttctaatg atatattaga agactttagc tcaatttcga ataacgtaaa tgattatggt       360
     tatgataatt tagatgaaaa tgttaattta atgtccttta ttgaagtaac agaagtatta       420
     aatgatggtc aaaatacacc acccgaaagt aacgtagatt atgttgtaag tgaattgaac       480
     gacgatatta ttgatgaaga agaagataaa cgacttaagg aagcatatga aagaatatta       540
     aggaaaagac gtggaatttc aggaaggcat ccatatcata tattaacaag tagttgtaat       600
     gagtttaatt caaataacat aataaacgaa gaggaattag atcatgttga attaatacaa       660
     aatgaaatgg attctgattc atataatgta ttaacagaag aagatgtaca aaatattaat       720
     tcgtcatata ataatgaaga acttaataat aataataata ataatattag atcaacaagt       780
     gagaataatg ttaatacgta tgaattacct aatggagaat tacataataa ttctgataga       840
     ttaaatggtg cagatgtagt aaatatgaac ttatatttta atggagatgt gtatagttca       900
     cttgagaatt tagaagaaac ggtagaaaca agaaatgaag aagatgaaga taacgaagat       960
     gatgaagaag aatttgaaaa gatgttaaat gaattaaaaa ataatggaac acttggtgaa      1020
     acatgtagaa tatggaataa attgtgtttt attgaaaata agaaatttta taatatgcaa      1080
     atgaaattat ggaatttttg cgaaatatta gcatttgaat ataaaatacc tcaaagtact      1140
     ttagcaaatg aatggaaaaa aattgttact tatacaaatg aagaattgat tcaacataat      1200
     ttaactaata tttcggattt taatacttta gtatttaata aaatatatga cgcactggat      1260
     tttatagaat tcataaaaca caaaagagaa tcatggaaac aatttagaga aagtgaagaa      1320
     cctgtatgga aaaacacact cgaaaaaaat tttaaaaatt atgtacaata a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page