(data stored in ACNUC9543 zone)

EMBL: AL844507.PE296

AL844507.PE296       Location/Qualifiers
FT   CDS_pept        join(1307053..1307163,1307379..1307924)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830700"
FT                   /product="Plasmodium exported protein (hyp9), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.3:mRNA"
FT                   /db_xref="GOA:Q8IBD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD3"
FT                   /protein_id="CAD51073.1"
FT                   /translation="MKSIINNRTFNKMNIFILFINILVIDLFCVSVEFFNKHCFYKTAN
FT                   ENVKLASSLSDRLSRSLALRSHNEVGQPVFNVLNVNLNTEIKKKDMITEVETEFEVLEV
FT                   CAEEEDGENEIRITMKTNLKPDMIKLRALNEEVTLKKWDFIMDDLAKCEYKKQKEKLNK
FT                   KTVVRKIAEGLGYTIVFTIGAPILLGASIVGACKWFLISKDSGKLFFKSLKEILF"
     atgaaaagta ttataaataa ccgtacattt aataaaatga atatatttat tttatttata        60
     aatatattgg ttattgatct tttctgtgtt tccgtagaat tttttaataa acattgtttt       120
     tataaaacgg ctaatgaaaa tgtaaaattg gctagctcac ttagtgatag gttaagtagg       180
     tcattagcac tacgttctca taatgaagtt ggtcaacctg tgtttaatgt tttaaatgta       240
     aatttaaata cagaaattaa gaaaaaggat atgatcactg aagttgaaac agaatttgaa       300
     gtattagaag tatgtgcgga agaagaagat ggtgaaaatg aaataagaat aacaatgaaa       360
     accaatttaa aaccagatat gattaaatta cgtgctttaa atgaagaagt gacattaaaa       420
     aaatgggatt ttattatgga cgatttagct aaatgtgaat ataaaaaaca aaaagaaaaa       480
     ttaaataaaa aaacagtagt tagaaaaatt gcagaaggtt taggttacac tattgttttt       540
     acaataggag ctcctatact tttaggtgct tcaattgtag gagcttgtaa atggttctta       600
     atatctaaag attctggaaa attatttttt aaatctttga aagaaatcct tttctaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page