(data stored in ACNUC9543 zone)

EMBL: AL844507.PE297

AL844507.PE297       Location/Qualifiers
FT   CDS_pept        join(1310637..1312343,1312513..1316955)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830800"
FT                   /product="surface-associated interspersed protein 8.2
FT                   (SURFIN 8.2)"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0002:mRNA"
FT                   /db_xref="GOA:Q8IBD4"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD4"
FT                   /protein_id="CAD51072.1"
FT                   /translation="MLMVIEFDDPIKEPSDKRISINRFREVFVNYVEDTLEELANNTTN
FT                   TYEKKCRDFNYFIDDVKDMFINHDLVKSTPEILKKVWESDIDKNLPGLMEKTTKNTCVR
FT                   VAHDYEKEYRDLRKNLEDFCDEKIERLAKLKISNNYMNDCFDYNKWINEKRNEFITGMT
FT                   GMDRRKKQMYLRKSDSCDLNNLANLFLNIICTRPRDVPGKPSSKDSGVKDKKKDDGSEE
FT                   EVVKDDNGDTSKGTSSDGDKDKSVEDTYDVDISEDGSPNEDISIVIEEPAQCEEGDHCF
FT                   DIIKFYESHKNGVPPIDINLSVRCPLNYHGIFRKGNKLYKSIENKSESNSMKRSSKRSI
FT                   GSENEQAISDNTDMEIIIDGDPYSAPCFIPEEEPCRPSVQETEGGKTGKGIFPHSESSN
FT                   NNVVPKTEVTLNFISPDRDRINPPERTYNLMNDGFMSTKNLLSVSGGNDIMYISHRSHA
FT                   APTNARLGRSTMTPKAEKSTLDDIKELIFSFPTNEAQKYESSSVTVPTSSTINQVNNDN
FT                   VSTHTGSNENGTVQKKDEIPETNRKENKIYSYFFNSILAIFIIFIIYQIFMKESTFLWF
FT                   SKNDKKRRIMKNIQEKVTKKMRKSDISEKFEKDIVDMKPTKSDIIRDRFIRNIYNVQYR
FT                   NEFDEEIKDYIQLKYLIYDDEERTKKKKYHEEYEKKDFQDDVIKTEKDKIFLSKEREWK
FT                   WKTIIEIHMEVLEDCKNEEWEKNKGDFLEICIEEFMKEDNEFNNNIKKNKDDLLINKNE
FT                   DIYFSNVIEKQIGLWNKWIERHRYMIEKWKKEDWFCDLKETLKNEFEEQMDIGKVSFLY
FT                   ENNREYGKNFYLEKQKIIWKRWIARYVKHIDDYIIEIWFKRMMDELEKAQGNLGKSSCE
FT                   KDEIINIESNHENLNFYKKKKKKLINKIWIQIHMMLLEEYKKEECKRSKNILLDNYIDI
FT                   LKRDGNEKKNMNILEILIEMKKKYISENEDYEKKVFKEDKVFEDYMGDWEYYEKNYINE
FT                   KENDTYKQDDIKIKKYFLENPFVEMEKDMTERYMNNIYDNYLSKGYEQETIIKSIHEIN
FT                   DTKKSIEEFHKEEKYDDTEKKKEKWKTVIEIYMEVFNESKKDEWEECRGDFLQICLEEF
FT                   LKTKDGINRDDNINEGDNINRDDNINEGDNINKGDNINKGDNINKGDNINKGDNINKDG
FT                   YINETDYLYSEENIKGYDHINTYPINGDIKNKYLLERQKIIWLKCIKRNKYILEKWKNE
FT                   EWFKKLKYNWNDEVNRKLHGNNLYDNVNTNNKRNPMIERQKIIWRKWIAKHVYNIDIME
FT                   NEEWFKEFIKKYEKEDYDYISGTYEIQEEIKKKKLLSKVFIDIYMMVLEDFKEEECKKN
FT                   KEIFLDTYIDELKKDSQSEKNKSMLNILDEIKSDIHIGYQKENMKEWKNKHWFEKLKKE
FT                   WNIRENKNYDEIEKNKMEKIHFTVINNYMLEIQNAIMKKYWDDMEIQWIDYDNKTDWLK
FT                   IAVQLSNNEKNVCNSRYDYIRNNNLYNKNKYMTIEEQDMKEVDTYDTYEKNLLFFERII
FT                   KMYMELLGEYKKADWDKNKGDFLKIALEEFVETKYEKQNDLRIIERINDNNNNEYDENY
FT                   ISIQQNLLWNKWIERKRYIIEKWKNEEWFEKLKSEWKKEQNKDIKQDQIQILIEKKENS
FT                   VTDNYDNINILTEIEKILWRNWLRNQKSVMGKYKDQKWFKDVLYKYEKELKELENLKSD
FT                   YLKNDISKIMDEELDMKNREYLIIQMWMEIHMMILEDCKKDEYINSEEIFLDACVEKLK
FT                   NEKNEKYQNRMLEIIMNIKEKHMLSKKEYMKNEWKKKEKLFEIFKKNCISEQDKYILEE
FT                   EIQKDIIKDIEKNKRYINNNDDIIKNGYIEKQKAICKKRVEKYLRHMDELSEENSFINF
FT                   MTKDQIRNSNNNELEKLIKEEILKKILSTEMDMTFLDEFNKGEFMENSEDSINVDIKRK
FT                   RKKKEKHIMENDDENIYKMENDDENIYKMEKEDNFININELELHKEFDNNNKVKLKELH
FT                   TEFHKDEQEILSSQYENIENAMINDNENYDNSNYMKNIIEQKMIILKEYYNRKKYTL"
     atgttgatgg tcattgaatt tgatgatcct attaaagaac cttcagataa acgaatttct        60
     attaataggt tcagagaagt ttttgttaat tatgttgaag atacacttga agaattagct       120
     aacaatacta cgaacacgta tgaaaaaaaa tgtcgtgact ttaattattt tattgatgat       180
     gtaaaggata tgtttattaa tcatgatttg gtaaaatcta ctcctgaaat acttaaaaaa       240
     gtatgggaaa gtgatataga taaaaattta ccaggcttga tggagaaaac aaccaaaaat       300
     acttgtgtta gagttgcaca tgattatgaa aaggaatata gagatttgag aaagaactta       360
     gaagattttt gtgacgagaa aattgagaga ttagcaaaat taaagataag caataattat       420
     atgaatgatt gttttgatta taataaatgg ataaacgaga aaagaaatga atttattacc       480
     ggtatgactg gtatggatag aagaaaaaaa caaatgtatt tacgaaaatc ggattcatgt       540
     gatcttaata atttagcaaa tttattttta aatataatct gtaccaggcc tagggatgtt       600
     cctggtaaac ctagtagtaa agatagtgga gtaaaggata aaaaaaaaga tgacggatct       660
     gaggaagaag tagttaaaga tgataatggt gatacttcta agggaacctc gagcgatgga       720
     gataaagata aatctgtgga ggatacatat gatgtagata ttagtgagga tggatcaccc       780
     aatgaggaca tatctattgt aatagaagaa cctgcacagt gtgaagaagg tgatcattgt       840
     tttgatatta taaaatttta cgaatcacat aaaaatggtg ttccccctat agatattaat       900
     ctatctgtta gatgcccttt aaattatcat ggaatatttc gaaaaggaaa taaactgtac       960
     aaatcaatag aaaataaaag cgaaagcaat tcaatgaaac gtagttcaaa acgatcgatt      1020
     ggtagcgaaa atgaacaagc tatttctgat aatacggata tggaaataat tattgatggt      1080
     gatccttact ctgctccttg ttttattcct gaggaagaac catgtagacc ttctgtacaa      1140
     gagactgaag gtggaaaaac aggaaaggga atttttcctc attctgaaag tagtaataat      1200
     aatgtagttc caaaaactga agttacatta aatttcatat cacctgatag ggatagaata      1260
     aatccgcctg aacgtactta taatttgatg aacgatggct ttatgagtac taaaaatctt      1320
     ttatcagtga gtggaggtaa tgatattatg tacatttctc atagaagcca tgcagctcct      1380
     actaatgcta ggttaggaag aagtacgatg acacctaaag ctgaaaaatc tacattagat      1440
     gatattaaag aattaatttt ttcttttcct actaatgaag ctcaaaagta tgaatcatca      1500
     agtgttactg ttcctactag ttcaacaatt aatcaagtaa ataatgataa cgtcagtaca      1560
     catacaggaa gtaacgagaa tggaactgta cagaagaaag atgaaattcc agaaacaaat      1620
     agaaaggaga ataaaatata ttcttatttt ttcaatagca ttttagcaat ttttataata      1680
     tttattattt atcaaatttt tatgaaagaa agtacctttt tatggttttc taaaaatgat      1740
     aaaaagagaa gaataatgaa aaatatacag gaaaaggtaa ctaaaaaaat gagaaaaagt      1800
     gatatatcag aaaaatttga gaaggatatt gtggatatga aacccacaaa aagtgatata      1860
     atacgtgata ggtttataag aaatatatat aatgttcagt atagaaatga atttgatgaa      1920
     gaaataaaag actatattca attaaaatat ttaatatatg acgatgaaga aagaacaaaa      1980
     aaaaaaaaat atcatgaaga atatgaaaag aaggatttcc aagatgatgt aataaaaaca      2040
     gaaaaggata aaatattttt gtcaaaagaa agagaatgga aatggaaaac cattattgag      2100
     atacatatgg aagtattaga agattgtaaa aatgaagaat gggaaaaaaa taaaggagat      2160
     tttttagaaa tatgtataga agaatttatg aaagaagata atgaattcaa taataatata      2220
     aaaaaaaata aagatgattt gttgataaat aagaatgagg atatatattt ttcaaatgta      2280
     atagaaaaac aaataggttt atggaataaa tggattgaga gacatagata tatgatagaa      2340
     aaatggaaaa aagaagattg gttttgtgat ttaaaagaaa cgttgaaaaa tgaatttgaa      2400
     gaacagatgg atataggaaa agtatctttt ttatatgaaa ataatagaga gtatggaaaa      2460
     aatttttatt tggaaaagca aaaaattata tggaaaagat ggattgcaag atatgtgaaa      2520
     catattgatg attatataat agaaatatgg tttaaaagaa tgatggatga attagaaaag      2580
     gcacaaggaa atttaggaaa atcttcttgt gaaaaggatg aaattataaa tatagaaagt      2640
     aatcatgaga atttaaattt ttataaaaaa aaaaaaaaaa aattaattaa caaaatatgg      2700
     atacaaatac atatgatgtt attagaggaa tataaaaagg aagaatgcaa acgaagtaaa      2760
     aatatcttat tggataatta tatagatatt ttaaaaagag atggaaatga aaagaaaaat      2820
     atgaatattt tagaaatatt aattgaaatg aaaaagaaat atatatctga aaatgaagat      2880
     tatgaaaaaa aagtatttaa agaagataaa gtgtttgaag attatatggg agactgggaa      2940
     tattatgaaa agaattatat aaatgaaaaa gaaaatgata cttataaaca agatgatata      3000
     aaaattaaaa aatatttttt agaaaatcct tttgtggaaa tggaaaaaga tatgacagaa      3060
     cgttatatga ataatatata tgataattat ttaagtaaag gctatgaaca ggagacaatt      3120
     ataaaatcca tacatgagat aaatgacaca aaaaaatcaa ttgaggaatt tcataaggaa      3180
     gaaaaatatg atgacacgga aaagaaaaag gagaaatgga aaactgtaat tgagatatat      3240
     atggaagtgt ttaatgaatc taaaaaggat gaatgggaag aatgtagggg agatttttta      3300
     caaatttgtt tggaagaatt tttaaaaaca aaggatggta ttaataggga tgataatatt      3360
     aatgagggtg ataatattaa tagggatgat aatattaatg agggtgataa tattaataag      3420
     ggtgacaata ttaataaggg tgacaatatt aacaagggtg ataatattaa caagggtgat      3480
     aatattaata aggatggtta tataaatgaa acagattatt tatatagtga ggaaaatata      3540
     aaaggatatg atcatataaa tacatatcca ataaatggag atattaaaaa taaatattta      3600
     ttagaaaggc aaaaaattat atggctaaaa tgcattaaga gaaacaaata tatattggaa      3660
     aaatggaaaa atgaagaatg gtttaaaaag ctgaaataca attggaatga tgaagtaaac      3720
     aggaaattac atggaaataa tttatatgat aatgtaaata caaataataa aagaaatcct      3780
     atgatagaaa ggcaaaaaat tatttggaga aaatggattg caaagcatgt atataatatt      3840
     gacataatgg aaaatgaaga atggtttaaa gaatttataa aaaaatacga aaaagaagat      3900
     tatgattata taagtggaac atatgaaatt caagaggaaa taaaaaagaa aaaattattg      3960
     tcaaaagttt tcatagatat atatatgatg gtattagaag attttaaaga agaagaatgt      4020
     aaaaagaata aagaaatatt tcttgatact tatatagatg aactaaaaaa agattcgcaa      4080
     agtgaaaaaa ataaaagcat gttaaatata ttagatgaaa taaaaagtga tattcatata      4140
     ggatatcaaa aagaaaatat gaaggaatgg aaaaataaac attggtttga aaaattgaaa      4200
     aaagaatgga atataaggga aaataagaac tatgatgaaa tagaaaaaaa taaaatggaa      4260
     aagatacatt ttactgtaat taataattat atgttagaaa tacaaaatgc tataatgaaa      4320
     aaatattggg atgatatgga aatacaatgg atagattatg ataataaaac ggattggcta      4380
     aaaatagctg ttcaattaag taataacgaa aaaaatgtat gtaacagcag atatgattat      4440
     attagaaata ataatttata taataaaaat aaatatatga ctatagagga acaagatatg      4500
     aaagaagttg atacatatga cacatatgaa aaaaatcttt tattttttga aaggattatc      4560
     aaaatgtata tggaactgtt gggtgaatat aaaaaagctg actgggataa aaacaaagga      4620
     gattttttaa aaattgctct agaagaattt gtagaaacaa aatatgaaaa acaaaatgat      4680
     ttaagaatta ttgaaagaat aaatgacaat aataataatg aatatgatga aaattatata      4740
     agtatacaac agaatttatt atggaataaa tggatagaaa gaaaaagata tataattgaa      4800
     aaatggaaaa atgaagaatg gtttgagaaa ttaaagagcg aatggaaaaa agaacaaaat      4860
     aaagatataa agcaagatca aatacaaatt ttgattgaaa aaaaagaaaa cagtgttact      4920
     gacaattatg ataatattaa tatattaaca gaaatagaaa aaatattatg gagaaattgg      4980
     ttaagaaatc aaaaaagtgt aatgggaaaa tataaggatc agaaatggtt taaagatgta      5040
     ttatataaat atgagaaaga actaaaagaa ttagaaaatt taaaaagcga ttatctgaaa      5100
     aatgatatat cgaaaataat ggatgaagaa ttagatatga agaatagaga atatttgata      5160
     attcaaatgt ggatggaaat ccacatgatg atattagaag attgtaaaaa ggatgagtat      5220
     ataaatagtg aggaaatatt tttggatgct tgtgtagaaa aattaaagaa tgagaaaaat      5280
     gaaaaatatc aaaataggat gcttgaaatt ataatgaata taaaggaaaa acatatgtta      5340
     tcaaaaaaag aatatatgaa aaatgaatgg aaaaaaaaag agaaattgtt tgaaattttt      5400
     aaaaaaaatt gtatcagtga acaagataaa tatatattag aagaagaaat tcagaaggat      5460
     ataattaaag atatagaaaa aaataaaaga tatattaata ataatgatga tataataaaa      5520
     aatggttata tcgaaaaaca aaaagctatt tgtaaaaaac gcgttgaaaa atatttaagg      5580
     catatggatg aattaagtga agaaaattcg tttataaatt ttatgacaaa ggatcaaata      5640
     agaaattcaa ataataatga attagagaaa cttattaagg aagaaatatt aaaaaagata      5700
     ttaagtacag agatggatat gacattcttg gatgaattta ataaaggtga atttatggaa      5760
     aatagtgagg attctataaa tgttgatata aaaagaaaaa gaaaaaaaaa agaaaaacat      5820
     ataatggaaa atgatgatga aaatatatat aaaatggaaa atgatgatga aaatatatat      5880
     aaaatggaaa aggaggataa ttttataaat ataaatgaac tggaattaca taaagagttt      5940
     gacaataata ataaagtaaa attaaaagaa ctacatacag aatttcacaa ggatgaacaa      6000
     gagatattat caagccaata tgaaaatata gaaaatgcaa tgataaatga taatgagaat      6060
     tatgataata gtaattatat gaagaatata attgaacaaa aaatgattat tctaaaagaa      6120
     tattataaca ggaagaaata tacactgtaa                                       6150
//

If you have problems or comments...

PBIL Back to PBIL home page