(data stored in ACNUC9543 zone)

EMBL: AL844507.PE298

AL844507.PE298       Location/Qualifiers
FT   CDS_pept        complement(join(1317600..1318109,1318273..1318341))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830900"
FT                   /product="Plasmodium exported protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0001:mRNA"
FT                   /db_xref="GOA:Q8IBD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD5"
FT                   /protein_id="CAD51071.1"
FT                   /translation="MLSFNVIYITCVVVIFSLQYNNKVNLHNKVHNIYKTRYSLIIYFK
FT                   RLLIEYNETVQLEKNPDENSSTELDDNESTVSVEECEKSLKEFFDDCKRENYPGNVIHL
FT                   CDNVEEPEEIKKGGSKTNLLLEEYGDPVVYDKEEMKLISELLDSYLEDERHLCMIKRIL
FT                   DYTKIYRNPLLLARYRIKKFLKRRCKKIK"
     atgttatctt ttaatgtcat ctatatcaca tgtgttgtag tcatattttc cttacaatat        60
     aataataaag ttaatttaca taacaaagta cataatatat acaaaacaag atactcatta       120
     attatatatt ttaaaagatt attgattgaa tataatgaaa ctgttcaatt agagaaaaat       180
     cctgatgaaa attcatcaac agaattggat gataacgaaa gtacagtaag tgttgaagaa       240
     tgtgaaaaat ctttaaaaga attttttgat gattgtaaga gagaaaatta tccagggaat       300
     gttattcatt tatgtgataa tgtagaggaa ccagaagaaa ttaaaaaagg gggatctaaa       360
     acaaatcttt tgttagaaga atatggagat ccagtagtat atgataaaga ggaaatgaaa       420
     ctgatttctg aacttttgga ttcttacctt gaagatgaaa gacatttatg tatgataaaa       480
     agaatattgg actatacaaa aatatataga aaccctttat tattggcgcg gtatagaatt       540
     aaaaaattcc ttaaaagacg ttgcaaaaaa attaaataa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page