(data stored in ACNUC9543 zone)

EMBL: AL844507.PE3

AL844507.PE3         Location/Qualifiers
FT   CDS_pept        join(40948..48582,49632..50939)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800300"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800300"
FT                   /db_xref="GOA:Q8IAK3"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK3"
FT                   /protein_id="CAD51361.1"
FT                   /translation="MVPPVRSPRAAGPAPAPASASTTYGSVKDLLEDIGKSIQKQAKDA
FT                   AEKRSNGELQGDLSKARFKDQKNTTTNPCQLNYRNHSNVRSSFENDNPCYGREEKRFSD
FT                   SRSGQCTYNRIKDSKEGDNKVGACAPYRRLHICDHNLENINDYKNINNHTLLVDVCLSA
FT                   KHEGEMIANKLKEYDKSNYESRICTVLARSFADIGDIVRGKDLYLGDQQEKLYLENNLK
FT                   KIFAKIHENLNDKIKSNYNDSEGNYFKLREDWWTANRDQVWKAITCNAPKDANYFEYNS
FT                   GKFFKFSNDQCGHNNGGAPPTNLDYVPQFVRWFEEWADDFCRIRKHKLKNIKDVCRNES
FT                   KPLYCSLNGYDCTKTSWKNDFESREHYCTPCFSACSLYKIWVANQKKEFEKQKKKYEKE
FT                   IPKYVSKKVKTNSTINNYYYYDFYEKLQKNEYGNIDAFLNLLKEGKYCKENLPEEEVIN
FT                   FTKHDEKKTFSLSNYCVVCPDCGVEYKNGRYTAKDQKYPDCRNEKYDPNNAETTDITVL
FT                   YSGDVGDFSEKLQDFCNDINNGKVKNYQIWQCYYENSEINKCQMTPSSHKVPKHGYIMS
FT                   FFAFFDLWVKNLLIDTINWKNELTNCINNTNVTDCKNDCNTNCKCFENWAKTKEKEWEN
FT                   VKTIYKNENRNTNNYYKKLNDLFKGYFFHVMYELNNEEAKWNKLMKNLRTKIDSSRKNA
FT                   GNEDSEGAIKVLFDHLKDIAERCIDNNSIKPCNSHPKPTPNPCGKNNNGGKLVRVKRPA
FT                   ELKQQKAHIQLEKRGGESNLKGDATRGTYNLGCQGDQLDATFCNIDEKYSNRIPRKSEG
FT                   PCYGKNPQRFYTGKDWTHVVQEKTSYKDVFLPPRREHMCTSNLENLNLNSKGLSNSSIA
FT                   SNSLLGDVLLAAKYEADDIVKKNDSDKSSICNAMKYSFADIGDIIRGKDMWDLDSGSKD
FT                   MEKHLISIFEKIKENLDVIKYNSKYKDTQKFLDLRSDWWEANRHQVWRAMKCAIENDKD
FT                   MKCNGIPIEDYIPQRLRWMTEWAEWYCKAQKKEYDELVKGCKGCMGNGQGCTKDSSDGE
FT                   CKKCTEACNTYKQKIKTWENQWKKIKGKYEKLYEQATKNGETSGTPNEKDKDVVDFLKQ
FT                   LLPRNSAAARNRVIRAAGSSAPGVTALTPITLYSSAAGYIHQELGKTVGCNTQKEFCKN
FT                   GSGEKYAFKHPPKEYKDACSCNTRDKKSEAPVTKKEEACKIVDGILKGNDGINEISGCN
FT                   PKESYPEWQCDKSKFKNGEEGACMPPRRQKLCVSGLTQGGKITTIEDIRTQFITCAAIE
FT                   THFAWHKYKKDNVNAERELNSGIIPHEFKRQMYYTFGDYRDIFFGTDISTHNHIPEVSQ
FT                   KVITILEKENLTKSEVKQKYKNELLDDWWNEHGKEIWDGMVCALCYDTKTKEFKNEVRT
FT                   QLTGPNSKYQYGTVSFGDKQNTILSKFAERPPFLRWFIEWGEEFCKKRKEQVDQLVNVC
FT                   KECNVSDSVISSGNKTCNDKEKCDACKKECTQYENWLQTWKGHYNKQKERYAKVKSTSP
FT                   YNNDNDVNKSTHAYEYLSKKLTNIPCTNGNTTGKCDYKCMDQRTSTDGMPASLEYPPKE
FT                   INGKCDCTKALPPQEPPSTPESRGRSLNPPPDSPQPPRGPEEQEESASYSEEEEEEEEE
FT                   EEENDEENDGDEEEVKTEDGGSDDEDEDEEDDEEEEENEVDVDEPQQEEVEEPPAKESA
FT                   PTTQEPAVPEVKKQEVKVCDIVSKILTKDALQDACKLKYNGKYYGWKCISGATTGGLCI
FT                   PPRRRKLYVTPLTKWATTAVSSEATPAPSQSESDKLREAFIQSAAIETFFLWHKYKQEK
FT                   KPPSEQNAGAALVLLQGVTPQEDPQNKLKSGTIPEEFKRQMFYTLGDYADIFFGKNDIL
FT                   IGKTGTGSAKDEMADKESKIKEAIKKFFQNGDSQPLSGKPVTQSSDKRTALWGDFAQDI
FT                   WHGMICALTYTDSGEKGELPKEDDKVKDKLWDDTKKQPKKEEYQYDKVKLDENSGDGPK
FT                   TSQPPSAPSDTPTTLDSFIKRPPYFRYLEEWGQNFCKKRTEMLGKIKGDCRVEDGSKNC
FT                   SGYGEDCDDQLGEDPSTVPSLKCQSCGEECRKYKKWIERKKDEFTKHSNAYGDQKAKCQ
FT                   AKSGGGGNGFCGTLERCSKAAEFLKTLGSCKTNNGNESVEANKTIFDNIGETFKPATNC
FT                   KPCSQFKIYCKNCKSSGDDTNVGCNCKENGNGYITSDHIKNEDNFTDPVDMLVSDDNTN
FT                   GNKFADLQACGGAGIFKGIRKDQWKCRNVCGYVVCKSEKGNGETVRGEKNDVKHIITIR
FT                   ALVTHWVEYFLDDYNKINKKLNRCMKDGEGYQCIKDCVEKWIQNKREEWKKIKELYLQE
FT                   YKNNNQPDYLVKIILEELHPQTQLNEAIKPCKTFDDFKSFCGLNGAESSKKSKNSNDND
FT                   LVLCMLNKLEKKIDECKQKHQASGKNTAQCQEYPPLPDEEYENEEENDKKVEPPTFCEI
FT                   KDTPEPADEDACKAAPKETAPSSEENQPETPVIKPEEEAPAPEEPPPAPPPLAPSDESI
FT                   LHTTIPFGVALALGSIAFLFLKKKTKSTIDLLRVINIPKSDYNIPTKLSPNRYIPYTSG
FT                   KYRGKRYIYIEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYVPGTPKYKTLIEVVL
FT                   EPSGNNTTASGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKDEFISQYLQSEQPKDVPN
FT                   DYKSGDIPFNTQPNTLYFDKPEEKPFITSIHDRNLYSGEEHSYNVNMVNSMDDIPINSH
FT                   NNVYSGIDLINDTLSGNQHIDIYDELLKRKENELFGTNHVKQTSIHSVAKPISDDPIHN
FT                   QLELFHKWLDRHRDMCEKWENHHERLAKLKEEWENDTSTSGNTHPSDSNKTLNTDVSIQ
FT                   IDMDNPKTTNEFTYVDSNPNQVDDTYVDSNPDNSSMDTILEDLEKYKEPYYDVQDDIYY
FT                   DVHDHDTSTVDTNAMDVPSKVQIEMDINTKLVKEKYPIGDVWDI"
     atggttcccc ctgtccgttc ccctcgtgcg gctgggccag cgccagcgcc cgcatcagca        60
     tccactacat atggtagtgt aaaggatctt ttggaggaca ttggaaagtc tatacaaaaa       120
     caagcaaagg atgccgctga aaaacgtagt aatggtgaat tgcaaggaga tttgtcaaaa       180
     gcaagattta aagatcagaa gaacacaacc acaaatccat gccaacttaa ttatagaaat       240
     cacagtaatg ttagaagtag ttttgagaat gataatccgt gttatggtag agaagaaaaa       300
     cgtttttctg actcacgcag tggccaatgt acatacaata ggataaaaga tagtaaggaa       360
     ggtgataata aagtaggagc atgtgctcca tatagacgat tgcatatatg cgaccataat       420
     ttggaaaata tcaatgatta taaaaatatt aataatcata cattattggt agatgtatgt       480
     ctttcagcca aacatgaagg agaaatgata gcaaacaagc ttaaagaata tgataaatct       540
     aattatgaat cacgaatatg tactgtattg gcgcgaagtt ttgcagatat aggtgatatt       600
     gtaagaggaa aagatcttta tttgggtgat caacaagaaa aattgtattt agaaaacaat       660
     ttaaaaaaaa ttttcgcgaa aatccatgaa aatttgaatg ataaaataaa atcaaactat       720
     aatgattccg aaggaaatta tttcaaatta agagaagact ggtggacggc taaccgcgat       780
     caagtatgga aagccatcac atgtaatgca ccaaaggatg ctaattattt cgaatataat       840
     tcaggtaaat tttttaaatt ttcaaatgat caatgcggcc ataataatgg aggtgctcct       900
     cctaccaatt tagattacgt ccctcaattt gtacgctggt tcgaggaatg ggcagatgat       960
     ttttgccgaa taagaaaaca taagttgaaa aatattaagg atgtttgtcg taatgaatca      1020
     aaaccattat attgtagtct taatggatat gattgtacaa aaactagttg gaaaaatgat      1080
     tttgagtcta gggaacatta ttgtaccccg tgtttttctg cctgtagtct ctataaaatt      1140
     tgggttgcca accaaaaaaa agaatttgaa aaacaaaaaa aaaaatatga aaaggaaata      1200
     ccaaaatatg tatcaaagaa ggtgaaaact aatagtacta ttaataatta ctattattat      1260
     gatttttatg aaaaacttca gaaaaatgaa tatggtaata ttgatgcatt tttaaattta      1320
     ctaaaagaag gaaagtattg taaagaaaac ttaccagaag aagaggttat taattttact      1380
     aaacatgatg aaaaaaagac attttctctt tcaaattatt gcgtagtatg tccggactgc      1440
     ggggttgaat ataagaatgg aagatataca gctaaagatc aaaaatatcc ggattgtaga      1500
     aatgaaaaat atgatcctaa taatgcagaa accactgaca ttactgtcct ctatagtggt      1560
     gatgttggtg atttttctga aaaattacaa gatttttgta atgacataaa taatgggaaa      1620
     gttaaaaact atcaaatatg gcaatgctat tatgaaaata gtgagattaa taaatgtcaa      1680
     atgacaccat catcacacaa agttccaaaa catggttaca ttatgtcatt ttttgctttt      1740
     tttgatttgt gggttaagaa tctattaata gacactataa attggaaaaa cgaacttaca      1800
     aattgtataa ataatactaa tgtcacggat tgtaaaaatg attgtaacac aaattgtaaa      1860
     tgttttgaaa attgggctaa aacaaaagaa aaagaatggg aaaatgtgaa gacgatatac      1920
     aaaaatgaaa acagaaacac gaacaattat tataaaaaac ttaatgatct ttttaaaggc      1980
     tatttttttc atgttatgta tgagcttaac aatgaagaag caaaatggaa taaacttatg      2040
     aaaaatttaa gaacaaaaat tgattcttcc agaaaaaatg caggtaacga agattcagaa      2100
     ggcgcaataa aagtgttgtt cgatcactta aaagatatag ctgaaagatg catagacaat      2160
     aattcaatca aaccatgtaa ctctcacccg aaacccacac caaacccctg tggaaaaaac      2220
     aataatggtg gcaaacttgt gagagtgaaa agaccagccg aattgaagca acaaaaggca      2280
     cacatacaat tggagaaacg tggcggcgaa agtaatttga agggggatgc aacaagaggg      2340
     acgtataacc ttggatgtca aggagaccaa ttggatgcca cattttgtaa catagatgaa      2400
     aaatattcca atcgtattcc tcgtaaatca gaaggaccat gttatggaaa aaatccacag      2460
     agattctata caggaaagga ttggacacat gttgtacaag aaaaaacgtc atacaaagac      2520
     gtctttttac ctccccgacg cgaacacatg tgtacatcaa atttggagaa tttgaacctg      2580
     aatagcaaag gacttagtaa tagtagtatt gcgagcaatt cattactagg tgatgtattg      2640
     ctcgcagcaa agtatgaagc agatgacata gtaaaaaaaa atgatagtga taaatcatca      2700
     atttgtaatg ctatgaaata tagttttgca gatattggtg atataatacg aggaaaagac      2760
     atgtgggatc tagacagtgg ctcaaaagac atggaaaaac atttgatatc catatttgaa      2820
     aaaattaaag aaaaccttga tgtcatcaaa tataactcca aatataagga tactcaaaaa      2880
     tttttagatt tacgttccga ctggtgggaa gctaatagac atcaagtttg gagagctatg      2940
     aaatgtgcaa tagaaaatga caaagatatg aaatgtaatg gtatcccaat agaagattac      3000
     ataccccaaa ggcttcgatg gatgaccgaa tgggccgaat ggtactgtaa ggcgcaaaaa      3060
     aaggagtatg acgagttggt gaagggatgt aaggggtgta tgggtaatgg tcaaggttgt      3120
     acgaaagata gtagtgatgg tgaatgtaag aagtgcacag aagcttgtaa tacatataaa      3180
     caaaaaataa aaacatggga aaatcaatgg aaaaaaataa aaggaaaata cgaaaaatta      3240
     tacgaacaag caacaaaaaa tggtgaaact agtggtactc ctaatgagaa agacaaagat      3300
     gttgttgatt tcttgaaaca attactacca cgaaatagtg ctgccgcacg taatcgtgtt      3360
     atacgtgctg ctggtagtag tgcccctggt gtcaccgccc tcaccccgat caccctctac      3420
     agttccgccg caggctatat ccaccaggaa ttggggaaga ccgtgggatg taacacgcag      3480
     aaggagtttt gtaagaacgg tagtggtgag aagtatgcgt ttaaacatcc gccaaaggag      3540
     tataaagatg cgtgtagttg taatactaga gacaagaagt cggaagcacc agtaacaaaa      3600
     aaagaagagg cgtgcaaaat agtggatgga atacttaaag gaaatgatgg aatcaatgaa      3660
     ataagtggat gtaatccaaa agagagttat cctgaatggc aatgcgacaa aagtaagttt      3720
     aaaaatggag aagaaggtgc ttgtatgcca cctagaagac aaaaattatg tgtaagtggt      3780
     ttaacacaag gaggtaaaat aacaacaata gaagatataa gaacacagtt tattacatgt      3840
     gcagctatag aaacacattt tgcttggcac aaatataaaa aggataatgt taatgctgaa      3900
     cgtgaattaa acagtggaat aattcctcat gaatttaaaa gacaaatgta ttatacattt      3960
     ggtgattata gagatatatt ttttggaaca gatatttcta cacataacca tattccagag      4020
     gtatcgcaaa aagtaataac cattttagaa aaggaaaatc ttacaaaatc cgaagtcaaa      4080
     caaaaataca agaacgaatt gcttgacgac tggtggaatg aacatggaaa ggagatatgg      4140
     gatggaatgg tatgtgcttt atgttatgat acaaaaacaa aagagtttaa aaatgaagtt      4200
     cgcacacaac ttaccggccc caacagcaaa taccaatacg gcacagtttc atttggtgat      4260
     aaacaaaata ccatcttgtc caaatttgca gaaagacccc cgtttttacg atggtttatt      4320
     gaatggggag aagagttttg taaaaaacgg aaagaacagg tggatcaatt ggtgaatgtt      4380
     tgtaaagagt gtaatgttag tgatagtgtt atcagtagtg gtaataaaac atgtaatgat      4440
     aaggagaaat gtgacgcgtg caaaaaagaa tgcacacaat atgaaaattg gcttcaaacg      4500
     tggaaaggac attataataa acaaaaagaa agatatgcta aggttaaatc aacatctcca      4560
     tataacaatg ataacgatgt gaacaaatcc acacatgcct atgaatattt gagcaaaaaa      4620
     ttaacaaata ttccatgtac aaatggaaat actactggaa aatgtgatta taagtgtatg      4680
     gatcaacgca cgtccactga tggtatgccc gcatcattag aatatccacc taaagaaatt      4740
     aatgggaagt gcgattgtac aaaggcttta ccaccacaag aaccaccatc aacacccgaa      4800
     agtcgtggcc gctccctaaa cccaccaccc gacagcccac aaccaccacg tggccccgaa      4860
     gagcaggagg aatccgcctc atactcagaa gaagaagaag aggaagagga ggaggaagag      4920
     gaaaacgacg aggaaaacga cggcgacgag gaggaggtga aaacagaaga cggcggcagt      4980
     gacgacgaag atgaagatga ggaagacgac gaagaggaag aagaaaacga agtcgacgtg      5040
     gacgaaccac aacaagagga ggtggaggaa ccaccggcaa aggagtcggc accaacaaca      5100
     caagaaccgg cggtaccaga ggtaaaaaaa caggaagtaa aggtgtgcga catagtgtcc      5160
     aaaatactta ctaaagacgc tcttcaagat gcatgtaaat taaaatataa cggaaaatat      5220
     tatggatgga aatgcataag tggtgccacc accggtggtt tgtgtatccc acccaggagg      5280
     cgaaaactat atgtcacacc actaacgaag tgggcaacta ccgcggtgtc gagtgaagcc      5340
     actccggcgc cgtcacagtc agaaagtgac aaactgcgtg aggcatttat tcaatctgcg      5400
     gcaatagaga cttttttctt atggcataag tataaacaag agaaaaaacc accatcagaa      5460
     caaaatgcag gagcagcact tgtattactg cagggggtaa caccacagga ggatccccaa      5520
     aacaaattaa aaagtggtac catccctgag gaatttaaac gacaaatgtt ctatacacta      5580
     ggggattatg cagatatatt ttttgggaaa aatgatatcc taattggaaa aacaggtact      5640
     ggtagtgcaa aagatgaaat ggctgataaa gaaagtaaaa taaaagaagc tataaaaaag      5700
     ttttttcaaa atggtgattc ccaacctctt agtggaaaac ctgtcaccca atctagtgat      5760
     aaacgtacag ccttgtgggg cgacttcgcg caggatattt ggcatggaat gatttgtgct      5820
     ttaacctata cagatagtgg cgaaaaaggc gaactaccaa aagaggatga caaagtgaaa      5880
     gataaacttt gggatgacac caagaaacaa cccaaaaaag aagaatacca atacgacaaa      5940
     gtaaaactcg acgaaaatag tggtgatggc cccaaaacct cccaaccccc ctcagcccct      6000
     agtgataccc ccaccaccct tgactccttc atcaagcgac ccccttattt ccgttacctt      6060
     gaagaatggg gtcaaaattt ttgtaaaaaa agaacagaga tgttggggaa gataaagggg      6120
     gactgtcgtg tagaagatgg ttcaaaaaac tgtagcggtt atggtgagga ttgtgacgat      6180
     cagcttggtg aggatcctag tactgttcca tctttaaaat gtcagagttg tggagaagaa      6240
     tgtagaaaat ataaaaaatg gatagaaaga aaaaaagacg aatttactaa acattcaaat      6300
     gcatatggtg accaaaaagc aaaatgccaa gcgaaaagtg ggggtggtgg taatggattt      6360
     tgtggaacac tagaaaggtg ctctaaagct gcagaatttt taaaaacgtt aggatcatgt      6420
     aaaactaata atggaaatga gagtgtagag gctaataaaa cgatttttga taatatcggt      6480
     gaaacattta aacctgcaac aaattgtaaa ccttgttctc aatttaaaat atattgtaaa      6540
     aattgtaaga gtagtggtga tgatacaaac gtggggtgca attgcaaaga gaatggaaat      6600
     ggttatatta cttcagatca tattaaaaat gaagacaatt ttactgaccc agtagatatg      6660
     cttgtgagtg atgacaatac aaatggaaat aaatttgcag atttacaggc ttgtggaggt      6720
     gccggtatat ttaaaggtat tagaaaagac caatggaaat gtcgtaatgt atgtggttat      6780
     gttgtatgta aatcggaaaa gggtaatggg gaaaccgtca gaggggaaaa aaatgatgtt      6840
     aaacacatta taacaattag agctttggtt acacattggg tagaatattt tttagacgat      6900
     tataataaaa ttaacaaaaa attaaaccga tgtatgaaag atggtgaagg ataccaatgt      6960
     ataaaggatt gcgtagaaaa atggatacag aacaaaagag aagaatggaa aaaaataaag      7020
     gaactttacc ttcaagaata taaaaataat aatcaacctg attacctagt gaaaattatt      7080
     ttggaggaat tgcatcccca aactcaactt aacgaagcta taaaaccttg taaaactttt      7140
     gacgatttca agagtttttg tggtcttaat ggcgctgaga gctcaaaaaa gagtaaaaat      7200
     agtaatgata acgaccttgt tctatgtatg cttaataaac ttgaaaaaaa aattgacgaa      7260
     tgcaaacaga aacaccaagc tagtggcaaa aacacagcac agtgtcaaga ataccccccc      7320
     ttacctgacg aagagtatga aaatgaagag gaaaatgata aaaaagtgga acctccaaca      7380
     ttttgtgaaa taaaggatac accagaacca gcggatgaag acgcttgtaa agcagcacca      7440
     aaagaaacgg caccatctag tgaggaaaac caacccgaaa cccctgtgat caaacccgaa      7500
     gaagaagcgc cggcaccaga ggaacctcca cccgcgcctc caccattagc cccttctgac      7560
     gaatccatcc tacatactac catccctttt ggagtggcgt tagcattagg atccattgct      7620
     tttttatttt tgaagaaaaa aaccaaatct actattgatc ttttgcgtgt cattaatatc      7680
     cccaaaagtg attataatat accgacaaaa ctttcaccca atagatatat accttatact      7740
     agtggtaaat acagaggcaa acggtacatt tatatagaag gagatagtgg aactgatagt      7800
     ggttacaccg atcattatag tgatattact tcttcctccg aaagtgagta tgaagaattg      7860
     gatattaatg atatatatgt accaggtact cctaaatata aaacattgat agaagtggta      7920
     ctagaaccta gtggtaacaa cacaacagct agtggtaaaa acacacctag tgatacacaa      7980
     aatgatatac aaaatgatgg tatacctagt agtaaaatta cagataatga gtggaataca      8040
     ttgaaagatg aatttatatc acaatatcta caaagtgaac aaccaaagga tgtaccaaat      8100
     gattataaaa gtggtgatat tccattcaat acacaaccga atactttata ttttgataaa      8160
     cctgaagaaa aaccttttat tacttctatt catgatagaa atttatatag tggagaagaa      8220
     catagttata atgttaatat ggttaatagt atggatgata ttccaattaa tagtcataat      8280
     aatgtataca gtggtataga tttaattaat gacacattaa gtggtaatca acatattgac      8340
     atatatgatg aattattaaa aagaaaagaa aacgaattat ttgggacaaa tcatgtgaaa      8400
     caaacaagta tacatagtgt tgccaaacct ataagtgacg accccatcca caaccaactg      8460
     gaactattcc ataaatggct agatagacat agagatatgt gcgaaaagtg ggaaaatcat      8520
     cacgaacgat tagccaaatt gaaagaagag tgggaaaatg atacatcaac tagtggtaac      8580
     actcacccta gtgatagtaa caaaacgtta aatactgatg tttctataca gatagatatg      8640
     gataatccca aaactacaaa tgagtttaca tatgtggata gtaaccccaa ccaagtggat      8700
     gacacctacg tggatagtaa ccctgacaat tcttccatgg atactatctt ggaagatctg      8760
     gaaaaatata aagaacctta ttatgatgtg caagatgata tttattatga tgtacatgat      8820
     catgatacat caactgtgga tactaatgct atggatgtac ccagtaaagt acaaattgaa      8880
     atggatataa atactaaatt agtgaaagag aaatatccta taggagatgt gtgggatata      8940
     taa                                                                    8943
//

If you have problems or comments...

PBIL Back to PBIL home page