(data stored in SCRATCH zone)

EMBL: AL844507.PE30

AL844507.PE30        Location/Qualifiers
FT   CDS_pept        complement(199181..202918)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803100"
FT                   /product="U3 small nucleolar RNA-associated protein 14,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0127:mRNA"
FT                   /db_xref="GOA:Q8IAN1"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAN1"
FT                   /protein_id="CAD51332.1"
FT                   /translation="MNYDEDIKRRKKKKTEKLKNTKESLSLYESNNKNILSIKNKKLLK
FT                   DKKNKMKIQKMKNKYDKDDGTIKHKKGNKIISSDDKFDEDITNLYMKKSKKCMKDTMVK
FT                   KKKKKMKNQNYEKDKNYIGVVMDEDEIIIDNEERIIENVNNVENDHVPYTNDSDKSDEE
FT                   YSSVNFMKFLKNCNDNEREVNKKKKKKKKSTDGNHKNDDHNDDNDDDNDDDDNDDDNND
FT                   DDNNDDNDDDNNDDDNNDDDNNDDNDDDNIKKKLVHSGDQDDHHVDDDSSSVQDSYQYY
FT                   ALKDDMYKLSNENKEKIEFADLMYSNNNFFGQGLQKDLDFLENEQNKKKGKKRLSFIEE
FT                   QKFNTTLGYVQNVKLLNKMNKAYNVIQNSSKVEFGRQKEKRGNQGEDFVNKRLVKRFLK
FT                   RKEKIQPEMYDGHEESGYIDDNDDNIINNNILKRHKVDQTHLNGYGEQNEVYNKKEKKI
FT                   IKREHKKEEDFTIYNFEEEIKMNLLKSKMLHISEDLLKNEKEKKRDELKKIAQLKLLLS
FT                   IENRKNYYKKKIKSKSYRKYLRIKEKKEEEKIMKKLYSEHPDLVKDLMNYEKEYAEKRN
FT                   LLNNIKKRKTIKTLNRYKNEQLKKEILKSIQSNKEEKNMLKKIIEKTALTEQTNEDNNM
FT                   MIHDDNDDDDDDNMSEDTDEISSKDHDNMNYSDKCSNDNIKNDDDLYDKKRKKKIYDEF
FT                   EKRNLLRFSFVKNAEENKRNDEIYNRRKDILKKLENRNKKNMDNTYEDNNNNNKYNVDE
FT                   DNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVD
FT                   EDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNSLDSFSSDEIIKNDE
FT                   ESHILFSNNKLSDYSHKELSKAKKELKNDIDFVNSLKKTDILHIDDVEDITDVISGYDE
FT                   EDNEKNGNVNNDNVNNDNVNNDNVNNDNVNNDNINNDNINNDNVNNDNVNNDKEMKLLD
FT                   DITSADTNVSPNEHLKGDVKDKEDIEVGSKTKKKKSQSNNTTSSSSSNNWNNNLDGEGD
FT                   KEKKNKTKVIENNLKTINEVNNEHILESYCKNINVYNFENNTYEDYINPKNDDIKEDEE
FT                   LYELSEDEKIKDIEVNKKEWCNYNTLLELEKNKMIKEKEIIETKKNKPLHTITLHNKKD
FT                   KKFDKYYVDKIPYPYDKNGYEKTLNININKEINDLSAYKQLIAPQYSNKVGNVISPLIK
FT                   NPFDLANIFTLKRKNQKSKL"
     atgaattatg atgaagatat aaaaagaagg aaaaaaaaaa aaacagaaaa attaaaaaat        60
     actaaggaat cgttaagttt atatgagtca aacaataaga atattttatc tatcaaaaat       120
     aagaaattgt taaaagataa aaaaaataaa atgaaaattc aaaaaatgaa aaataaatat       180
     gataaagatg atggtactat aaaacacaag aagggtaaca aaattatctc ttctgatgat       240
     aaatttgatg aggacataac aaatttatat atgaaaaaat caaaaaagtg tatgaaagac       300
     acaatggtca aaaagaaaaa aaaaaaaatg aaaaatcaaa attatgaaaa ggataaaaat       360
     tatataggtg tagttatgga tgaagatgaa ataataatag ataatgaaga aaggattata       420
     gaaaacgtta ataatgtgga gaatgatcat gtgccttata caaatgattc tgataaaagt       480
     gatgaggaat attcatctgt aaactttatg aagtttttaa aaaattgtaa cgataatgag       540
     agggaagtaa ataaaaagaa aaagaagaaa aaaaaatcga ccgatggcaa tcacaaaaat       600
     gatgaccata atgatgataa tgatgatgat aatgatgatg atgataatga tgatgataat       660
     aatgatgatg ataataatga tgataatgat gatgataata atgatgatga taataatgat       720
     gatgataata atgatgataa tgatgatgat aatattaaga agaagcttgt ccattctggt       780
     gaccaagatg atcatcatgt tgatgatgat agtagtagtg tgcaagactc atatcaatac       840
     tatgccttaa aagacgatat gtacaaacta agcaacgaaa acaaagaaaa aatagaattc       900
     gctgacctaa tgtattcaaa taataatttc tttggacaag gtctacaaaa agatttagat       960
     tttttagaga acgaacaaaa taagaagaaa ggaaagaaac gcttatcctt tatagaggaa      1020
     caaaagttta atacaacatt aggatatgtg cagaatgtaa aattgttaaa taaaatgaac      1080
     aaggcttata atgttataca aaactctagc aaggtcgaat ttggacgaca aaaagaaaaa      1140
     agaggaaatc aaggtgagga ttttgttaac aaaagattag ttaaaagatt tttaaaaagg      1200
     aaagaaaaaa tacagcctga aatgtatgat ggacatgaag aaagtgggta tatagatgat      1260
     aatgatgata atattattaa taataatata ttgaaaaggc acaaagttga tcagactcat      1320
     ttaaatggat atggtgaaca aaacgaggtt tataataaaa aggagaagaa aataataaag      1380
     agagagcata aaaaggaaga ggactttact atatacaatt ttgaggagga aataaaaatg      1440
     aatttgctta aatctaaaat gttacatata tcagaggatt tattaaaaaa tgaaaaagaa      1500
     aagaaacgag atgagctaaa gaaaattgct caattaaaac ttttattatc tatagaaaat      1560
     agaaagaatt attataaaaa aaaaataaaa tctaaatcat atagaaaata tttaaggatt      1620
     aaagaaaaaa aagaagaaga aaaaattatg aagaagttat attcggagca tcctgatttg      1680
     gttaaagatt taatgaacta tgaaaaggaa tatgctgaaa aaagaaattt attaaataat      1740
     ataaaaaaaa gaaaaacaat aaaaacactt aatcgttata aaaatgaaca actgaaaaaa      1800
     gaaatcttga aaagtataca aagtaataaa gaagaaaaaa atatgttaaa aaaaattata      1860
     gaaaaaacgg ctttaaccga acaaactaat gaagataata atatgatgat acatgatgat      1920
     aatgatgatg atgatgatga taacatgtca gaagatactg atgagatatc ttcaaaggat      1980
     catgataata tgaattattc ggataaatgt tcaaatgata atataaaaaa tgatgacgac      2040
     ttgtatgata aaaagagaaa aaaaaaaata tatgatgaat ttgaaaaaag aaatttgtta      2100
     agattttcgt ttgttaagaa tgcagaagaa aataaaagaa atgatgaaat atataatagg      2160
     agaaaggaca tattaaaaaa attggaaaac agaaataaaa aaaatatgga taatacctat      2220
     gaagataata ataataataa caaatataat gttgatgaag ataataataa taaatataat      2280
     gttgatgaag ataataataa caaatataat gttgatgaag ataataataa caaatataat      2340
     gttgatgaag ataataataa taaatataat gttgatgaag ataataataa caaatataat      2400
     gttgatgaag ataataataa caaatataat gttgatgaag ataataataa caaatataat      2460
     gttgatgaag ataataataa caaatataat gttgatgaag ataataataa caaatataat      2520
     gttgatgaag ataataataa caaatataat gttgatgaag ataataattc gttggattcc      2580
     ttttcgtcag atgaaataat aaagaatgac gaagagagcc atattttatt ttctaataat      2640
     aaactttctg attatagtca taaagaatta tcgaaagcta aaaaggaatt aaaaaatgat      2700
     attgattttg taaatagttt gaagaaaaca gacatattgc atattgacga tgtggaagat      2760
     ataacagacg tgataagtgg atatgacgaa gaggataatg aaaaaaatgg taatgttaat      2820
     aatgataatg ttaataatga taatgttaat aatgataatg ttaataacga taatgttaat      2880
     aatgataata ttaataatga taatattaat aatgataatg ttaataatga taatgttaat      2940
     aatgataaag aaatgaaatt gttagatgat attacaagtg ctgatactaa tgtaagtcct      3000
     aatgaacatt taaaaggtga tgttaaggat aaagaagata tagaagtagg tagtaagaca      3060
     aaaaagaaga aatctcaaag taacaatact actagtagta gtagtagtaa taattggaat      3120
     aataatttag atggagaggg ggataaagaa aagaaaaata aaacaaaagt tattgaaaat      3180
     aatttgaaaa ctataaatga agtgaacaat gaacacatcc ttgaatccta ttgtaaaaat      3240
     ataaatgttt ataactttga aaataatact tatgaagatt atataaatcc taagaatgat      3300
     gatataaaag aagatgaaga attatatgaa ttaagtgaag atgaaaaaat aaaagatatt      3360
     gaagttaata aaaaagaatg gtgtaattac aatacgttat tagaattaga aaaaaataaa      3420
     atgataaaag aaaaagaaat aatcgaaaca aaaaaaaata aaccattaca tactataaca      3480
     ctacataata agaaagataa aaagtttgat aaatattatg tagacaaaat accatatcca      3540
     tatgataaaa atggatatga aaaaacttta aatataaata taaataaaga aataaatgat      3600
     ttgtcagcat ataaacaatt aatagcacca caatattcaa acaaagtagg aaatgtaata      3660
     tctcctttga ttaaaaaccc atttgattta gcaaatatat ttactttaaa aaggaaaaac      3720
     caaaaatcaa aattgtaa                                                    3738
//

If you have problems or comments...

PBIL Back to PBIL home page