(data stored in SCRATCH zone)

EMBL: AL844507.PE300

AL844507.PE300       Location/Qualifiers
FT   CDS_pept        join(1325144..1326008,1326176..1326402,1326514..1331187)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831100"
FT                   /product="surface-associated interspersed protein 8.1
FT                   (SURFIN 8.1)"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.1:mRNA"
FT                   /db_xref="GOA:C0H4Z4"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z4"
FT                   /protein_id="CAX64169.1"
FT                   /translation="MAIISSIPNYRKGLNPSLYNLRFSLFRDRVNAYTISKIKKLKKSR
FT                   NYKRLCRYLNYKLDDIKDVFMLNNVLGIPRTARMGLWENVMENKLKDIIEENSDNKCRR
FT                   IYPYFQRIQRRRRKALENFCEDKEKKQEELKNVKFDMKKCLEFNEWVKESENKIFKLFK
FT                   NNITERDKRKKAYIISDKCKLGNLNTLFGQMDCSDKIDRHFPYIFLEGNPVYPSEKDDD
FT                   KNIKDPEEGKDEEEEEEDGEVTINIRSNGEKGFRFVNNTLVLEGIEGSGFDLDFETYDI
FT                   SPHSLNSGEIANLFEFNNESHLEHMNIESNRSPNMVDIDFSDVPLTAAHMTSSITAKNI
FT                   SSYLYVPLGVLFIIISFIWFFLNRTKHLNMLIKEKEKVKTENIVPSEAYVKLDDLEVMS
FT                   EEIKEKQKEKLKKKIHAQKKLEIIEDPYKIKLLERKKWLWKTIIEIHMLILEEQRKAEW
FT                   EFNKGDFLNICIDEFSNQEKKPDTNIITSDLPFDEPEVIETIRMMNKQSDIWYRWVERH
FT                   AHMLEKWKEEEWFLRLKESWKDEEEEYMKRAYKELLISLRGDKYHMSQRQKIIWRKWIA
FT                   KHPYRIREFVIDKWFNQLFEELEKEGIISDEAIRNFLSQYEEAYDEEKIQEFIKYKKKV
FT                   LVVILWIKIYMSMLEEYVKEEDIESEKLFIDTSLEELKKKKEIEEEVLEDLKKDIYESD
FT                   EMKEIEKYKGEDWFKQMQQDWIRRDYKFVSSYNLESDDEEQFHEFVKKPTVEIQKDLLK
FT                   EQWKNIELKWIEEDNYDEYVLEDELLKETKYIKPKDKMKHRIIKEDNIYGEQLKVFDEI
FT                   EKRSIYLSSKRVLKWKTIIEIHLEVLHDCKKEEWDKNKRDFLNICIEELVKGQNEDKKN
FT                   KENYNYITNESDNYDIVEYTKSFCNTWKDRHNYMLEKWNKENWFVQLKNDWVEEQNEYM
FT                   RKTYKELLISLKGDKYNMSQRQKIIWRKWIAKHPYKINEEIINIWLNRLSDERDKNGII
FT                   SDEAIKKFLSLEKDISDKDFLKYRRKKLEVILWVKIYMSVLEEEKNEELEKSKESFLNT
FT                   CIDELKKEEYSEENERMITIVDEMKKGFRICDKVEDYKKKKWKNEEWYKDLKKEWIKEE
FT                   DKYIDSIYLMKKDEIYEDDLLNKSIVELEKSVSLKHWKDMYIKWIDEDNERDWLRIAID
FT                   KKNLKTDEINEDINRMIELNMLEDYSNDLYDKKKIKWKTIIEIHMEVLNDCKNDEWEMN
FT                   KGDFLDICLEEFGTMENKEYSHIINNMLMVGELEYKHLNMDVIERQNDLWNKWIEGHRY
FT                   MLEKWKKEKWFIVLKENWKNEEHKYMRKAYLELLMSLREDVKNPLLQRQKIIWRKWIAK
FT                   NLYHIESNVIKKWFDTLLEEIERKGVIELDGCINLIEMEENEEYLEYLKEYRKKKLICI
FT                   IWIKIYMMIIEEHKKEEYLECKEIFLDTCVDELREQEILEGNELYMDDMKTSILLNDQK
FT                   EEIEKLKMKKWYKDLKKEWIIEENRYFRSIINEEDDEEYKNMISKPLRDVEKKISKKHW
FT                   EDIQLKWIDEDNERDWLKIARNENEEIKYLYINENVSKKKKKVPFYIDDYRKKGRSNKN
FT                   KIYRRKREKCNVKLNENNTMNKEMENWENRMEFLKICVDLLKKRTFYYINIWEKNKAFY
FT                   DETNEIMKQLEEKIFERQKILWYNKEDMNKMSSKKWGNEEWFIILKNDWNEEKTCYLNG
FT                   IQYEYNINNLIEEEKKYLYLKKEKIIWKEWLLKNFKNIEECDNEDWFNNLMETYKIDEI
FT                   CTINMNGEIHSLGLENTLKRNFLKNIIWIDIFMGVLNACEEEEELEEHKHKNMLESKVE
FT                   DNDKLFYEKNEDYINKNEMENYINDIQENEGNQMDIPDWFDAYQSDEMSGKQKSIQKDE
FT                   QWFIKELEEGGIKSDVLQENYTIYNNKLIEQKMNILRESYIRNQNDT"
     atggctataa ttagttcaat acccaattat aggaagggac taaacccttc tttatataat        60
     ctacgttttt ctttattcag agacagagtg aatgcttaca ctatttctaa aattaaaaaa       120
     ttaaaaaaat ctagaaatta caaaagatta tgtagatatt taaattataa gttagatgat       180
     ataaaggacg tttttatgtt aaataatgta ttaggtattc caagaacagc tcgaatgggt       240
     ttatgggaaa acgttatgga aaataaatta aaagatatta tagaagaaaa ttctgataat       300
     aaatgtagaa gaatttatcc ttattttcaa aggatacaaa ggagaaggag gaaggctcta       360
     gagaattttt gtgaggataa ggaaaaaaaa caagaagaat taaaaaatgt taaatttgat       420
     atgaaaaaat gcttagaatt taatgaatgg gtaaaagaaa gtgagaataa aatttttaaa       480
     ttatttaaaa ataatataac tgaaagggat aaacgcaaaa aagcttatat tatatctgat       540
     aaatgtaagt tgggcaatct aaatacatta tttggacaaa tggactgttc cgataagatt       600
     gatagacatt ttccttatat tttccttgaa ggaaatcctg tatatccatc tgaaaaggat       660
     gatgataaaa atataaagga tccagaagaa ggaaaagatg aggaagagga agaagaggat       720
     ggagaggtta ctattaatat ccgtagtaat ggtgaaaaag gatttcgttt tgtcaataat       780
     acacttgttc tagaaggaat agaaggttca ggatttgatt tggattttga aacttatgat       840
     atttctcctc attctttaaa ttctggcgaa atagctaatt tattcgaatt taacaatgaa       900
     tcacatcttg aacatatgaa tatcgagtca aacagaagtc cgaatatggt agatattgat       960
     ttttctgatg ttcctcttac tgctgcgcat atgacctcct cgataactgc taaaaatatt      1020
     tcatcttacc tatatgttcc tctaggtgta ttattcatta ttatttcctt tatatggttt      1080
     ttcctaaata gaacgaaaca tttgaatatg ttgataaagg aaaaagaaaa agtaaaaaca      1140
     gaaaatattg ttccttcgga agcatatgta aaattagacg acttggaagt gatgagtgag      1200
     gaaattaaag aaaagcaaaa ggaaaaatta aaaaaaaaaa tacacgctca aaaaaaactt      1260
     gaaattatag aggaccctta taaaattaaa ttgttagaaa gaaagaaatg gttatggaaa      1320
     actattatag aaatacatat gttaattttg gaagaacaaa gaaaagcaga atgggaattt      1380
     aataaaggag attttttaaa tatatgtatt gatgaatttt caaatcagga aaaaaaacca      1440
     gatacaaata taataacaag tgatttgcca tttgatgaac cagaagttat agaaactata      1500
     cgtatgatga ataagcaaag cgatatatgg tatagatggg ttgaacgaca tgcacatatg      1560
     ttagaaaaat ggaaagaaga agaatggttt ttaagattaa aagagagctg gaaagatgaa      1620
     gaagaagaat atatgaaaag agcttataaa gaattattaa ttagtttaag aggtgataaa      1680
     tatcatatgt ctcaaaggca aaaaattatt tggagaaaat ggattgcaaa acatccatat      1740
     agaatcagag aatttgttat agataaatgg tttaatcaat tatttgaaga actagaaaag      1800
     gaaggaatca tatctgatga ggccataaga aattttttat ctcaatatga agaagcatat      1860
     gatgaagaaa aaatccaaga atttataaaa tataaaaaga aagtgttggt ggttatatta      1920
     tggataaaaa tatatatgtc aatgttggag gaatatgtaa aggaagaaga tatagaaagt      1980
     gaaaagttat ttattgatac atctttggaa gaattaaaaa agaaaaaaga aatagaagaa      2040
     gaagtgttag aagatttgaa aaaagatata tatgaaagcg atgaaatgaa agaaattgaa      2100
     aagtataaag gagaagattg gtttaagcaa atgcagcaag attggattag gagagattat      2160
     aaatttgttt cgtcatataa tttagaaagt gacgatgaag aacagtttca tgaatttgtt      2220
     aaaaaaccaa cagtggaaat acagaaagat ttattaaaag aacaatggaa aaatatagaa      2280
     ttgaaatgga ttgaggaaga taattatgat gaatatgtgt tagaagatga attgttaaaa      2340
     gaaacgaaat atataaagcc taaagataaa atgaaacata gaataattaa agaggataat      2400
     atttatggtg aacaattaaa agtgtttgat gaaatagaaa aaaggagcat ttatttgtcg      2460
     agtaaaaggg tattgaaatg gaaaaccatc attgaaatac atttggaggt attacatgat      2520
     tgtaaaaagg aagagtggga taaaaataaa agggactttt taaatatatg tatagaagaa      2580
     ttggtaaagg gacaaaatga agataaaaaa aataaggaaa attataatta tataacaaat      2640
     gaaagtgata attacgatat agtggaatat accaaatcat tttgtaatac gtggaaagat      2700
     agacacaatt atatgttaga aaaatggaat aaagaaaatt ggtttgttca attgaaaaat      2760
     gattgggtgg aggaacaaaa tgaatacatg agaaagacat acaaagaatt attaattagt      2820
     cttaagggtg acaaatataa tatgtcgcag agacaaaaaa taatttggag gaaatggatt      2880
     gcaaaacatc cttacaaaat aaatgaagaa attataaata tatggttaaa tcggttatcg      2940
     gatgagagag ataaaaatgg tattattagt gacgaagcta taaaaaagtt tttatcttta      3000
     gaaaaagata tatcggataa ggatttcctt aaatatagga ggaaaaaatt agaagtaatt      3060
     ttatgggtaa aaatatatat gtctgttttg gaagaggaga aaaatgaaga attagaaaaa      3120
     agtaaggagt cctttttaaa tacatgcata gatgagttaa aaaaggaaga atattctgaa      3180
     gaaaatgaaa gaatgataac aatagttgat gaaatgaaaa agggatttcg tatatgtgat      3240
     aaggtagaag attacaaaaa aaaaaaatgg aaaaatgaag aatggtataa ggacttaaag      3300
     aaagaatgga taaaagaaga agataaatat atagattcta tttatttaat gaaaaaggat      3360
     gaaatatatg aagatgattt gttgaataaa tccattgtgg aattagaaaa aagtgtatca      3420
     ttaaaacatt ggaaagatat gtatataaaa tggattgatg aagataacga gagagattgg      3480
     ttacgtattg caatagataa aaaaaattta aaaacagacg aaataaatga agatataaat      3540
     agaatgatag aattaaatat gttggaagat tattcaaatg atttgtatga taaaaaaaaa      3600
     ataaaatgga aaactatcat cgaaatacat atggaagttt tgaatgactg caaaaatgat      3660
     gaatgggaaa tgaataaagg agacttttta gatatatgct tagaagaatt tggaactatg      3720
     gaaaacaagg aatattccca tattataaat aacatgttga tggtaggaga actagaatat      3780
     aaacatttga atatggatgt aatagaaaga caaaacgatt tgtggaacaa atggatagaa      3840
     ggacacagat atatgttaga aaaatggaaa aaagaaaaat ggtttattgt attgaaagag      3900
     aattggaaaa atgaagagca taaatatatg agaaaggctt atttagaatt gttgatgagt      3960
     ttaagagagg atgttaaaaa tccgctgtta caaaggcaaa aaattatatg gagaaaatgg      4020
     attgcaaaaa atttatatca tatagaatca aatgttataa aaaaatggtt tgatacatta      4080
     ttagaagaaa ttgaaagaaa aggagttatt gaattagatg gatgtataaa tttaatagag      4140
     atggaagaaa atgaagaata tttggaatat ttaaaagaat atagaaagaa aaaattaata      4200
     tgtatcatat ggataaaaat atatatgatg ataattgagg aacacaaaaa ggaggaatat      4260
     ttggaatgta aggaaatatt tttggatact tgtgtggatg agttgagaga gcaagaaatt      4320
     ttggagggta acgaattata tatggatgat atgaaaacaa gtatcctatt aaatgatcaa      4380
     aaagaagaaa tagaaaaatt aaaaatgaaa aaatggtata aagatttgaa gaaagaatgg      4440
     ataattgaag aaaatagata tttcagatca ataataaatg aagaagatga tgaagaatat      4500
     aaaaatatga taagcaagcc attaagagat gttgagaaaa aaatatcaaa aaagcattgg      4560
     gaagatattc aattaaaatg gatagatgaa gataatgaaa gggattggtt aaaaattgca      4620
     aggaatgaaa atgaagagat taaatattta tatataaatg aaaatgttag caaaaaaaaa      4680
     aaaaaagtac ctttttatat agatgattac cgaaaaaaag gaagatcaaa taaaaataaa      4740
     atatatagaa gaaaaaggga aaaatgtaat gtaaaattaa acgaaaataa tactatgaat      4800
     aaggaaatgg aaaattggga aaacagaatg gaatttttaa aaatttgtgt tgatttgtta      4860
     aaaaaaagaa ctttttatta tataaatata tgggagaaaa ataaagcatt ttatgatgaa      4920
     acaaatgaga taatgaaaca attggaagaa aaaatatttg aaaggcagaa aatattatgg      4980
     tacaataaag aagatatgaa taaaatgtca agcaaaaaat ggggaaatga agaatggttt      5040
     attattttga aaaatgattg gaatgaagaa aaaacgtgtt atctgaatgg aatacaatac      5100
     gaatataata ttaataattt aatagaagaa gaaaaaaaat atttgtactt gaagaaagaa      5160
     aagataatat ggaaagaatg gttattaaaa aattttaaaa atattgaaga atgtgataat      5220
     gaagattggt ttaataattt aatggaaaca tataaaatag atgaaatatg tacaattaat      5280
     atgaatggag agatacatag tcttgggttg gagaatactc taaagagaaa ttttttaaaa      5340
     aatataatat ggattgatat atttatggga gttttaaatg catgtgaaga agaagaagaa      5400
     ttggaagaac acaaacataa gaatatgtta gagtcaaaag tcgaagataa tgataaatta      5460
     ttttatgaaa aaaatgaaga ttatattaat aaaaacgaaa tggaaaatta tataaatgat      5520
     atacaagaaa atgaaggaaa tcaaatggat attccagatt ggtttgatgc atatcaatct      5580
     gatgaaatga gtggaaaaca gaaaagtatc caaaaagatg aacaatggtt cattaaagaa      5640
     ttagaagagg ggggtataaa aagtgatgtt ttacaagaaa attatacgat atataataac      5700
     aaattgatag agcaaaaaat gaatatactt cgagaaagtt atattagaaa tcaaaatgat      5760
     acataa                                                                 5766
//

If you have problems or comments...

PBIL Back to PBIL home page