(data stored in ACNUC9543 zone)

EMBL: AL844507.PE302

AL844507.PE302       Location/Qualifiers
FT   CDS_pept        join(1339659..1339742,1339925..1342306)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831300"
FT                   /product="Plasmodium exported protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.205:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z6"
FT                   /protein_id="CAX64171.1"
FT                   /translation="MEYIHILRKLLFSYFSVVLLGIIYEIPVDLSVYDETEQSGVKYLN
FT                   ICSRKLSETEKDHIPSLRCHELKYKSKDEINEESCINREDFKEFDIKDENEEVKMDEYE
FT                   NDEEETYEEEEEYIDEKNENYENKEDISDREDLSDMENNNDKDDLSDMENNNDKDDLSD
FT                   MENNNDKDDLSDMENNNDKEDLSDKEDLSDKEDLSDKEDLSDREDLSDKEDLSDKEDLS
FT                   DKEDLSDKEDLSDREDLCDKENLSDKEDLSDMEYSNDKDDFSDMEYSNDKDDFSDKEDI
FT                   NDREDFSDKENSYNEEYNNNGEEENFKREKYDKTIINNLYYSKWNVGVENDENKWIDEN
FT                   HELMDKWSLIKNCTNGKWIDCEKIHDEYRKKKNYDDSMWENIKQDDEVDEWDLGHEKEK
FT                   DKWVFVEGYDYTNSVIEEENDDELKNIESDDEQKWDFSEDEEDKSDSVEERNDVEHQKK
FT                   IEEEKDDENSNSGKWDFIRNKENGWGILENQKERMNFSEKDENRINLIELYFDNVYNYV
FT                   DRKYENEDLISSEPEKVNVMKQEEEYNKNDDIDMNKYSKKDIGMFYLYQEELKNEGDKE
FT                   ELINKRDNKRNKENDEDITIENDEQILNGNYEKEGKSKELKGENDCINESSENIIKKKT
FT                   DKKEDINNNNNTTENNENIDYNKFIKDLKEDKVDNVFHGFGSYPLKKDILGLWWEALSI
FT                   IKLGFEIITRDFKSYMKTYLDKYEYNHRSTYEYPFIWSYIQSTWGRCILNLGMEVASEQ
FT                   KEFSRNFYHLLNKTANLEDITNFIYSGMMYFEKLRKRLLYKYKHTFRSKIKNLPDNALN
FT                   IKFYQGKLI"
     atggaataca tacatatttt aagaaaactt cttttcagct atttttctgt ggttctttta        60
     ggaattatat atgaaattcc agtagattta tctgtgtatg atgaaactga acaatcagga       120
     gtaaaatatt taaatatttg ttcaagaaaa ttatctgaaa cagaaaaaga tcacatccca       180
     tcattaagat gtcatgaatt aaagtataaa tcgaaagatg aaataaatga agaaagttgt       240
     attaatcgtg aggattttaa agagtttgat attaaggatg aaaatgaaga agttaaaatg       300
     gatgaatatg aaaacgatga ggaagaaaca tatgaagaag aagaagaata tattgatgag       360
     aaaaatgaaa attatgaaaa taaagaggat attagtgata gggaagattt aagtgatatg       420
     gaaaataata atgataagga tgatttaagt gatatggaaa ataataatga taaggatgat       480
     ttaagtgata tggaaaataa taatgataag gatgatttaa gtgatatgga aaataataat       540
     gataaggaag atttaagtga taaggaagat ttaagtgata aggaagattt aagtgataag       600
     gaagatttaa gtgataggga agatttaagt gataaggaag atttaagtga taaggaagat       660
     ttaagtgata aggaagattt aagtgataag gaagatttaa gtgataggga agatttatgt       720
     gataaggaaa atttaagtga taaggaggat ttaagtgata tggaatatag taatgataag       780
     gatgatttta gtgatatgga atatagtaat gataaggatg attttagtga taaggaagat       840
     attaatgata gggaagattt tagtgataag gagaatagtt ataatgaaga atataataat       900
     aatggagaag aggaaaattt taagagagag aaatatgata aaacaattat taataattta       960
     tattatagta aatggaatgt gggtgtagaa aatgatgaga ataaatggat agatgaaaac      1020
     catgaattaa tggataagtg gagtttgatt aaaaattgta caaatgggaa atggatagat      1080
     tgtgaaaaaa ttcatgatga atatagaaaa aaaaaaaatt acgatgattc aatgtgggaa      1140
     aatattaaac aggacgacga agttgatgaa tgggatttag gacatgaaaa agaaaaagat      1200
     aaatgggtat ttgtagaggg atatgactat actaattcag ttatagaaga agaaaatgac      1260
     gatgaattaa aaaatattga atcagatgat gaacagaaat gggatttctc agaagatgaa      1320
     gaagacaaat ctgattctgt agaagagaga aatgatgtcg aacaccaaaa aaaaatcgaa      1380
     gaagaaaaag atgatgaaaa cagtaattct ggtaaatggg attttataag gaataaagaa      1440
     aatggatggg gtattttgga aaatcaaaaa gaaagaatga atttttcaga gaaagatgaa      1500
     aatagaatta atttaattga attatatttt gataatgttt ataattatgt agatagaaaa      1560
     tatgaaaacg aggatttgat atcaagtgaa ccagaaaaag taaatgttat gaaacaagag      1620
     gaggaatata ataaaaatga tgatatagat atgaataaat atagtaaaaa agacatagga      1680
     atgttttatt tgtaccaaga agaactgaaa aacgaaggtg ataaggaaga attgataaat      1740
     aagagagata acaaaaggaa taaagaaaat gatgaagaca ttaccataga aaatgatgaa      1800
     caaattctta acggaaatta tgaaaaagaa ggaaaatcaa aggaacttaa aggagaaaat      1860
     gattgtatta atgaatcatc tgaaaatatt attaaaaaaa aaacagataa aaaagaggat      1920
     attaataata ataataatac tacagagaat aatgaaaata tagattataa taaatttata      1980
     aaagatttaa aagaagataa ggttgacaat gtttttcatg gttttggaag ttatccacta      2040
     aagaaagata tccttggttt atggtgggaa gcacttagta taattaaatt aggttttgaa      2100
     ataataacaa gagattttaa gagttatatg aaaacttatt tagataaata tgaatataat      2160
     catagatcaa catatgaata tccttttata tggagttata ttcaatcaac ttggggaaga      2220
     tgcatactta atcttggaat ggaagtagct tctgaacaaa aagaattttc tagaaatttc      2280
     tatcatttac ttaataaaac agccaatctt gaggatatta caaattttat ttattctggg      2340
     atgatgtatt ttgaaaaatt aagaaagcgc ttattatata aatataagca tacgttccgt      2400
     agtaaaatta agaatctacc agataatgct ttaaatataa aattttacca aggtaaactt      2460
     atttag                                                                 2466
//

If you have problems or comments...

PBIL Back to PBIL home page