(data stored in ACNUC9543 zone)

EMBL: AL844507.PE303

AL844507.PE303       Location/Qualifiers
FT   CDS_pept        complement(join(1344405..1345241,1345416..1345487))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831400"
FT                   /product="Plasmodium exported protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.206:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z7"
FT                   /protein_id="CAX64172.1"
FT                   /translation="MMRILYTNVFLFIAVLFCILSPGNNPLHKYVEIKEGINNLSIHAH
FT                   LRLLTEIMENCSLNGFRLNDKNGEHDEEEERKCDDDQHSENQEHECDNDQHSENQEHEC
FT                   DNEQNDESKCEESNNTDQADVNYLSMPIQIPYLRNEIMDDNYYSRYFDSNIMRTDEVTT
FT                   RLNDQNLIEKCLCKLKAGKYINEAKIKYAHEIIDSMKLTDKVKDIFKEFMRYYIWKRYP
FT                   SHQLRLYKKIKKDIEKYTRNHVICSLIDFETIEDELYYLIYPNREMYMSFDTAVNTKRR
FT                   KKIKKLMREKARKDKEKNGYI"
     atgatgagaa ttttatatac caacgtattt ctatttattg ctgtactctt ttgcattcta        60
     tcacctggaa ataacccact ccataaatat gttgaaataa aagaaggaat aaataattta       120
     tctattcatg cacatttaag gctattaaca gaaataatgg aaaattgttc tttaaatgga       180
     ttcagattaa atgacaaaaa tggagaacat gatgaagaag aagaacgtaa atgtgatgat       240
     gatcaacata gtgaaaacca agaacatgaa tgtgataatg atcaacatag tgaaaaccaa       300
     gaacatgaat gtgataatga acaaaatgat gaatctaaat gtgaagagtc aaataatact       360
     gatcaagctg atgtcaatta tctatcgatg cctatacaaa taccttactt aagaaatgaa       420
     attatggatg ataattatta tagtcgttat tttgatagta atattatgag aacagatgaa       480
     gtaactactc gattaaatga tcaaaactta atagaaaaat gtttatgtaa attaaaagca       540
     ggtaaatata taaacgaggc aaaaataaaa tatgcacatg aaataataga ttccatgaaa       600
     cttacagata aagtaaaaga tatatttaaa gaattcatgc gttattatat atggaaaaga       660
     tacccaagtc atcaacttag gttatataag aaaattaaaa aggatatcga aaaatacaca       720
     aggaatcatg ttatttgttc tcttatagat tttgaaacta tagaagatga actatattat       780
     ttaatatacc ctaatagaga aatgtacatg tcttttgata cagcagtgaa tactaaaaga       840
     agaaaaaaaa ttaaaaaact aatgagagaa aaagcaagga aagataaaga aaaaaatgga       900
     tatatttag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page