(data stored in ACNUC9543 zone)

EMBL: AL844507.PE304

AL844507.PE304       Location/Qualifiers
FT   CDS_pept        join(1353456..1353650,1353857..1354669)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831500"
FT                   /product="Plasmodium exported protein (PHIST), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831500"
FT                   /db_xref="InterPro:IPR006526"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZW02"
FT                   /protein_id="CZT62757.1"
FT                   /translation="MSLFTKFNSQDYKNGITKNLSNTEQNNIININNGYKKKTSWNCLG
FT                   SFRNICLTLCVITALYIQFKNKYGENSSCVVQLDKISSRNLSDVQVENFPSLNHGDKTY
FT                   KKNDEKDESNNENSNINKQADEDNEEVSQNNNNSNNNSKNNNSNNNVNNNISNVSNDSG
FT                   NVVGKKIKKKTYLNYNDMTKQLTKEELFYVLDSLKKVPGRRNLNNIWKHALGVISDILD
FT                   EKLIDLNVYIQKYKKKYESKRDEQSYRISKSGLMEKYLDEFDERIMEQRMTYSSNFKHL
FT                   IHKSPSLDDIKNFIHTFIDDLEKLINYMYGSYKHIFQLVNEEPSKASFNDFIFK"
     atgagcttat ttacaaaatt taattctcaa gactataaaa atggaattac aaaaaattta        60
     tcaaatacag agcaaaataa tataattaat ataaataatg gatataagaa aaagacatca       120
     tggaactgtt taggttcttt tagaaatata tgtttaacat tatgtgttat aacagcatta       180
     tatatacaat tcaaaaataa atatggggag aatagttcat gtgttgtaca gttggataag       240
     ataagttcaa gaaatttatc tgatgtacaa gtagaaaatt ttccttcttt aaatcatggt       300
     gataaaactt ataaaaaaaa tgatgaaaaa gacgaatcga ataatgagaa ttcaaatata       360
     aataaacaag cagatgaaga taatgaagag gtttcacaaa acaataataa tagtaataat       420
     aatagtaaga ataataacag taataataat gtaaataata atataagtaa tgttagtaat       480
     gattcaggaa atgtcgtagg taaaaagatt aagaagaaaa catatttaaa ttataatgat       540
     atgacaaaac aattaacaaa ggaagaatta ttttatgttc ttgattcttt aaaaaaggta       600
     ccaggaagaa gaaaccttaa taatatatgg aaacatgctc ttggtgtaat aagcgatata       660
     ttagatgaaa aattaattga tctaaatgta tatatacaga aatataaaaa gaaatatgaa       720
     agtaaacgtg atgaacaatc ttatcgtatt agtaaaagtg gtttaatgga aaaatattta       780
     gatgaatttg atgaaagaat aatggaacaa agaatgacat atagtagtaa ttttaaacat       840
     ttaatacata aaagtccttc attagatgat ataaaaaatt tcattcatac atttatagat       900
     gatttagaaa agttaataaa ttatatgtat ggtagttata aacatatatt tcaattagta       960
     aatgaagaac catctaaagc aagttttaat gattttatat ttaaatga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page