(data stored in ACNUC9543 zone)

EMBL: AL844507.PE305

AL844507.PE305       Location/Qualifiers
FT   CDS_pept        join(1358314..1359142,1359287..1359859,1360002..1360055,
FT                   1360151..1360213,1360362..1360493,1360628..1360813,
FT                   1360942..1361100,1361249..1362015,1362197..1363618)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831600"
FT                   /product="cytoadherence linked asexual protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831600"
FT                   /db_xref="GOA:A0A143ZVM1"
FT                   /db_xref="InterPro:IPR005553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZVM1"
FT                   /protein_id="CZT62758.1"
FT                   /translation="MISYFKVVVFIIFFFLFLKRRVICSINESKNVNENLNGDSNPNDN
FT                   INQLKSMIGNDELHKNLTILEKLILDSLENDKLKSPLVKQETDKYLDLSKFKKKSINDA
FT                   DDDIYIVPTIQSSFYDIAKYENLLKEQSIESYNANISDLIKKKLLIVRTLKTIKLMLIP
FT                   LNSYKEKNNLKIALEELNKVFKNNINQSEKKRLLNSHSETFRNILNVVDEVNKSNEIIN
FT                   KGEAIILGDTKIDLMSTNDFFFTTNSNIKFMEELDNISNQYGLGLITQLGPHLIALGHF
FT                   MILKLALKYYDIYFELKTVKFFSWQKILQFNMSDRYKILDILCFQNAVYYSEKKRRKTY
FT                   MKVDRSNTNMECNILEFLIHFFNKYQLEIIKITEDTDFDLHGMMEHKHIKDGFFSYICN
FT                   DPKECIIYHTNRFKKEKDEEDTFEVQDTSHNISAYNLYLNYYYFMKRYSSYGMKKTTYV
FT                   HLLNLTGLLNYDTRAYVTSLHLPGYYNTIEMSFTEETELPTLFDHSLECIRKCYLDERY
FT                   EYTSFMKHIPLDSNFMNEVSKCNLCKGAFLYANLKFDNVPSMLQKFYIYVTQGLKLQKV
FT                   TSLVRTLDIYQDYSNFLSHDVNWYTFLFLFRITSFQKIAQKNVVESLYLNLKDEDSFHR
FT                   TVTTCYWFPSPIKKYYTLYVRKHLPNNLLDELLRQMRKSTIEKMKKSITFLVHVNSFLQ
FT                   LDFFHNLNEAPFGLPRAHPLSLILEHKFKEWIDSSPAGFYFSNYQNPYIRRELHNRVLD
FT                   LKFEPPKINEWNKVLKRIIESAYEMYFEQRHVKSLFKYHNIYNINNKIMLMRDAYDIFR
FT                   KNVDDILFFADIINIRKYLTATPLVKKGMDRIFYVIHNILGNSVNYYKYGIIYGFKVNK
FT                   EILKEVVDELFSIYNFNTDIFTDISFLQTVYLLFRKIEDTYKTQRRNDRMSINNIFFMN
FT                   VANNYSKLNMEQRELEIHNSMASRFYSKTMFSAFQMLFSTMLSNEANHLDKVYGKSGKI
FT                   GLATSVTAYLTFAYVYNGSIMDSITNSLLPPYAKKPITQLKYGRTFVFSNYFMLASKMY
FT                   EMLNYKNLSLLCEYQAVVSANYYSSKKVDQFLGRKFFPLTTTFLIKRISTSIDHISGGK
FT                   WYNLFGCLGKDPPAYLYFHFFLNLYFDSGKYFPGGFSTSLREQTEHVKKKGFPKKPSVH
FT                   GFTQMVFLQLTNIVMYALCFMSLSQIYAYFENVNFYIISNFRFLERYFNIFNKYFVELF
FT                   RRKLKEYTSDVLLKYEYETYINIRKRGYLDEAMEARITAKNNVKEYLYDNDENVMINLR
FT                   RYAMENMHKINLSTYVDDYIYFDDCGKNEEFLNDRCDICPVYEESDEDDQKALSSNSKA
FT                   ITQIKSKTTTYIDYKKFPKEVSTKISEEENSDDDMNLTDNALMITKIPEDE"
     atgatatcat attttaaggt agtagttttt ataatatttt tctttctatt tctaaaaaga        60
     agagtaattt gttccattaa tgagagtaaa aatgtgaatg aaaatttaaa tggagattca       120
     aatccaaatg acaatataaa tcaattaaaa tctatgattg gaaatgatga actacataag       180
     aatttaacga tactagaaaa acttatatta gattcgttag aaaatgataa attaaaatcc       240
     cctctagtaa aacaagaaac cgacaagtat ttggatttat ctaaatttaa aaaaaaaagc       300
     ataaatgatg cagatgatga tatatatatt gtaccaacta tacaatcaag tttttatgat       360
     attgcaaaat atgaaaattt attaaaggaa caatcaatag aatcttataa tgcaaatatt       420
     tcagatttaa ttaaaaaaaa attacttatt gtaagaacat taaaaactat aaaattgatg       480
     cttataccat taaattctta taaagaaaaa aataatttaa aaattgcact agaagaatta       540
     aataaagtat ttaaaaataa tataaatcaa tcagaaaaaa agcgtttatt gaatagccat       600
     agcgaaacat tcagaaatat tttaaatgtt gttgatgaag ttaataaatc aaatgagatc       660
     ataaataaag gtgaagctat aattcttgga gatactaaaa tagatctaat gagtacaaat       720
     gacttttttt ttacaaccaa cagtaatata aaatttatgg aagaattaga taacatatca       780
     aatcaatatg gattaggttt aattacccag cttggtcctc accttatagc tctgggacat       840
     tttatgatat taaaattagc acttaaatat tatgatatat actttgaact aaaaacagta       900
     aaatttttta gttggcaaaa aatattgcag tttaatatgt cagacaggta taaaatactt       960
     gatattttgt gttttcagaa tgctgtatat tattcggaaa aaaagcgtag aaaaacctat      1020
     atgaaagttg atagatctaa tacaaatatg gaatgtaata tcctggaatt tttaattcat      1080
     ttttttaata aatatcaact ggaaataatt aaaattacgg aagatacgga tttcgactta      1140
     catggtatga tggagcacaa acatataaaa gatggattct tttcatatat atgtaatgat      1200
     cctaaagaat gtattatcta ccatacgaat cgatttaaaa aagaaaagga tgaggaagat      1260
     actttcgaag tacaagacac tagtcacaat attagcgcat acaatttata cttaaattat      1320
     tactatttta tgaaacgtta tagttcttac ggaatgaaaa aaactacata tgttcattta      1380
     ttaaatttaa ctggactttt aaattacgat actagggctt atgtaacatc acttcattta      1440
     cctggatatt acaacactat agaaatgtca tttactgagg aaacagaact tcctacatta      1500
     tttgatcatt ctttggaatg tattagaaag tgctatttag atgaaagata tgaatatacc      1560
     tcattcatga aacatattcc cttagatagt aattttatga atgaagtatc aaagtgcaat      1620
     ttgtgtaaag gagcattctt atatgctaat ttaaaatttg ataatgttcc ttccatgtta      1680
     caaaagtttt acatatatgt aactcaaggt cttaagctcc aaaaagtaac atcattagtt      1740
     agaacattag atatttatca agattacagt aattttttat ctcatgatgt taattggtat      1800
     acattcttat ttttatttag aattacaagt tttcaaaaaa ttgcacaaaa aaatgtggtt      1860
     gaatctttgt atttaaattt gaaagacgaa gattcatttc atagaactgt tactacatgt      1920
     tactggtttc catcacccat aaagaaatat tacacattat atgttagaaa acatctccca      1980
     aataatttat tggatgaatt attgagacaa atgcgtaaat ctacaataga aaagatgaaa      2040
     aaatctatca cgtttttagt acatgttaat tcatttttac aattagattt ttttcataac      2100
     cttaatgaag caccttttgg attaccccgt gcacatcctt tatcattaat tcttgaacat      2160
     aaatttaaag aatggataga tagttcccct gcaggttttt atttctcaaa ttatcaaaat      2220
     ccatatataa gaagagaatt acataatcga gtattagatc tgaagttcga accaccaaaa      2280
     ataaatgaat ggaataaagt tttaaaaaga ataattgaat ctgcgtatga aatgtatttt      2340
     gaacaaaggc atgttaaaag tttatttaaa tatcataata tttataatat aaataataaa      2400
     ataatgctaa tgagagatgc atatgatata tttagaaaga atgttgacga tattttattt      2460
     tttgctgata taattaatat cagaaaatat ttaacagcaa cacctttagt taaaaagggt      2520
     atggatagaa tattttatgt tattcataat attttaggaa attctgtaaa ttattataaa      2580
     tatggtatta tatatggttt taaagtaaat aaagaaattt tgaaagaagt ggtagatgag      2640
     ctcttttcaa tttataattt caatacagac atatttacgg atatatcttt cttgcaaact      2700
     gtttatttac tctttagaaa aatagaagac acttacaaga ctcaaaggag aaacgataga      2760
     atgagtataa ataacatatt ttttatgaat gttgcaaata attattctaa attaaatatg      2820
     gaacaaaggg aattagaaat acacaattcg atggcctcaa gattttattc aaaaacaatg      2880
     ttttctgcct ttcaaatgtt attttctaca atgttgagta atgaagcaaa tcatcttgat      2940
     aaggtttatg gaaaaagtgg taaaataggt ttagcaacaa gtgttactgc atatcttact      3000
     tttgcttatg tatataatgg aagtattatg gatagcataa ctaatagttt attaccacca      3060
     tatgctaaaa aaccaataac tcaattaaaa tatggaagaa cgtttgtttt ttcaaattat      3120
     tttatgttag catctaaaat gtacgaaatg ttaaattata aaaatttaag tcttttgtgt      3180
     gaatatcaag ctgtagtaag tgcaaattat tactcttcta aaaaggtaga tcaattcctt      3240
     ggtagaaaat tttttcctct tactacaaca ttcctgatta agagaataag tacatcaatt      3300
     gatcatatta gtggaggcaa atggtataat ttatttggtt gtttgggtaa ggatccccca      3360
     gcatatttat attttcattt ttttcttaat ttatattttg attctggaaa atattttcct      3420
     ggaggttttt cgacttcttt aagagaacaa acagaacacg taaaaaaaaa gggttttcct      3480
     aaaaaaccat cggttcatgg ttttacacag atggtgtttt tgcagcttac taatatagtc      3540
     atgtatgccc tttgttttat gagcctttca caaatatatg cttatttcga aaacgtgaat      3600
     ttttatatta taagcaattt tcgtttcctt gagagatatt ttaatatatt caataaatac      3660
     tttgtagaac tattcagaag aaaacttaaa gagtatacaa gtgatgtact tctaaaatac      3720
     gagtatgaaa cttatataaa tataagaaaa cgtggttatc ttgatgaggc aatggaagct      3780
     agaattacag ctaaaaataa tgtaaaggaa tatttatatg ataatgatga aaatgttatg      3840
     attaatttaa gaagatatgc tatggaaaat atgcataaaa ttaatctgtc gacatatgta      3900
     gatgattata tttattttga tgattgtggt aaaaatgagg aatttctaaa tgatagatgt      3960
     gatatatgtc ctgtttatga ggaatccgat gaagatgatc aaaaggcttt atcgtcaaat      4020
     agtaaggcta taacacaaat aaaaagtaaa acaacgacat atattgatta taaaaaattt      4080
     cctaaagaag tttcaacaaa aatatcggaa gaagaaaata gtgatgatga tatgaattta      4140
     actgacaacg cactgatgat tacaaaaata cctgaagatg aataa                      4185
//

If you have problems or comments...

PBIL Back to PBIL home page