(data stored in ACNUC9543 zone)

EMBL: AL844507.PE306

AL844507.PE306       Location/Qualifiers
FT   CDS_pept        complement(1365467..1367506)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831700"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831700"
FT                   /db_xref="GOA:K7NTP5"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:K7NTP5"
FT                   /protein_id="CZT62759.1"
FT                   /translation="MKTKICSYIHYIVLFLIATTTVHTASNNAEESEVAIGIDLGTTYS
FT                   CVGICRNGVVDIIANDQGNRTTPSYVAFTDTERLIGDAAKNQASRNPENTVFDAKRLIG
FT                   RKFSETTVQSDMKHWPFTVKGGSDGKPMIEVSYQGEKKTFHPEEISSMVLKKMKEVAET
FT                   YLGKPVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGKGE
FT                   QNILIFDLGGGTFDVSLLTLEDGIFEVKATSGDTHLGGEDFDNKLVNFCVQDFKKKNGG
FT                   KDVSKNSKSLRRLRTQCEKAKRVLSSSAQATIEVDSLFDGIDYNVNITRAKFEELCMDQ
FT                   FRNTLIPVEKVLKDAKMDKSQVHEIVLVGGSTRIPKIQQLIKDFFNGKEPCKAINPDEA
FT                   VAYGAAVQAAILSGDQSSAVKDLLLLDVCPLSLGLETAGGVMTKLIERNTTIPTKKNQI
FT                   FTTYADNQPGVLIQVYEGERAMTKDNNLLGKFQLEGIPPAPRSVPQIEVTFDIDANGIL
FT                   NVTALDKGTGKQNQITITNDKGRLSKDDIDRMVNDAEKYKEEDEQNKNRIEARNNLENY
FT                   CYNVKNTLQDENLKTKIPKDDSEKCMKTVKSVLDWLEKNQTAETEEYNEKEKDISSVYN
FT                   PIMTKIYQGASAQEPQKAEATNLRGRNSENKEAQNNGPTVEEVN"
     atgaagacaa aaatttgtag ttatattcat tatattgttt tatttttaat tgcaacaaca        60
     acagtacata cagcaagtaa caatgcagaa gaatcagagg ttgcaattgg tattgattta       120
     ggtaccacct attcatgtgt tggtatatgt aggaatggtg tagtggatat tatagctaat       180
     gatcaaggta atagaactac cccatcttat gttgctttta cagatacaga acgattaatt       240
     ggtgatgctg ctaaaaacca agcctccagg aatccagaaa atacagtttt tgatgcaaaa       300
     agattaatag gaagaaaatt ttcagaaaca actgtacaaa gtgatatgaa acactggcca       360
     tttactgtaa aaggtggttc tgatggaaaa ccaatgattg aagtatcata tcaaggagaa       420
     aaaaaaacat tccatccaga agaaatatct tcaatggtat taaaaaaaat gaaagaagtt       480
     gcagagacat acttaggaaa accagttaaa aatgctgtta ttactgttcc agcttatttc       540
     aatgattcac aaagacaagc taccaaagat gcaggtgcca ttgctggttt aaatgtttta       600
     agaattatta atgaaccaac tgcagcagct atagcatatg gtttagataa aaaaggaaaa       660
     ggtgaacaaa atattcttat tttcgattta ggaggaggaa catttgatgt ttccttatta       720
     acacttgaag atggaatttt tgaagttaaa gctacctcag gagatacaca tttaggagga       780
     gaagattttg ataataaatt agtaaacttc tgtgtacaag attttaaaaa aaaaaatgga       840
     ggtaaagatg tttccaaaaa ttcaaaatca ttaagaagat taagaacaca atgtgaaaaa       900
     gctaaacgtg tattatcatc atccgcacaa gcaactattg aagttgattc tttatttgat       960
     ggaatcgatt ataatgtaaa tataaccaga gccaaatttg aagaattgtg tatggatcaa      1020
     ttccgtaata ctttaatacc tgttgaaaaa gtcttaaaag atgcaaaaat ggataaaagc      1080
     caagtacatg aaattgtttt agttggtggt tcaacaagaa ttccaaaaat acaacaactt      1140
     atcaaagatt ttttcaatgg aaaagaacca tgtaaagcca ttaatccaga tgaagctgtt      1200
     gcatatggtg cagctgtaca agcagccatc ttatcaggtg atcaatcatc agctgtcaaa      1260
     gacttattat tattagatgt atgtccattg tcattaggtt tagaaacagc aggtggtgtc      1320
     atgaccaaat taattgaaag aaatacaact ataccaacaa aaaaaaatca aatctttaca      1380
     acatatgctg ataaccaacc aggtgtttta attcaagttt atgaaggaga aagagccatg      1440
     acaaaagata ataacttatt aggaaaattt caattagaag gtatcccacc agcaccaaga      1500
     agtgtaccac aaatcgaagt tacatttgat attgatgcta atggtatcct aaatgtaaca      1560
     gcattagata aaggtactgg taaacaaaac caaattacta ttacaaatga taaaggaaga      1620
     ttatcaaaag atgatatcga tcgtatggta aatgatgcag aaaaatataa agaagaggat      1680
     gaacaaaata aaaatagaat tgaagcaaga aacaacctag aaaattactg ctataatgtt      1740
     aaaaacacat tacaagatga aaatttgaaa acaaaaatac caaaagatga ttcagaaaaa      1800
     tgtatgaaaa cagttaaatc tgttcttgat tggttagaaa aaaatcaaac agcagaaact      1860
     gaagaatata atgaaaaaga aaaagatatt tcatcagtat ataatcctat aatgactaaa      1920
     atatatcaag gtgcatcagc acaagaacca caaaaagcag aggcaaccaa cttaagaggt      1980
     cgtaattcag aaaataaaga agcacaaaat aatggaccaa ccgttgaaga agtaaattaa      2040
//

If you have problems or comments...

PBIL Back to PBIL home page