(data stored in ACNUC9543 zone)

EMBL: AL844507.PE31

AL844507.PE31        Location/Qualifiers
FT   CDS_pept        complement(join(204241..204477,204712..206661))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803200"
FT                   /product="filament assembling protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.146:mRNA"
FT                   /db_xref="GOA:Q8IAN2"
FT                   /db_xref="InterPro:IPR008374"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAN2"
FT                   /protein_id="CAD51331.1"
FT                   /translation="MFYNKENHNNNNKKKDPETFKKRDDSFLIYKESIKSFNNNHLSSC
FT                   EEKKDNINNNKCNINSFVYTSEFEELYNKDKDFLGDINNTYNKQRKENSFYENSSNLSQ
FT                   NTEEYSSNNFVASHNINIEEKNLNKKKKSTKYKKKNKELNNVYIKNKSELYKVHKLYNK
FT                   SNQQYIKEQEKEIQEKEEVDLDVEGEETEITRQVYQKNLEYKENKKEQKEQKKEDQEEE
FT                   KEEEKGEEEEKEEKEKETYSKLYNFSYELENNFFEKNMNNSLNLTRNNIMNFCDYNKMN
FT                   KPFSEKVNKNYVKMNMNNVSHVNSMDNINHAYNINKMNKFNNTSNTNHMDNTNHTNHMD
FT                   NTNHINHMDNTNHINHMDNTNHINHMNHMGDVNHVNNMSNVNNTHYNNQSTHLTNMKHL
FT                   NHINSMASLNNVRNNNDLIFNNEEIFFNSKKINMDKGSNAKKTNLVYNSKKSSNMEYEK
FT                   NENMLFNQGVKKTLDINEKCINNNTKIKIKRLCEKIEGFEKEIKNEILQKKNVEKEKIY
FT                   IIREAINKLEKNLNNEIKKRIEHNRNIQNIFSSEILKVQEKIENVVHDKVYEIENAIKV
FT                   LNEKINNISSNIENEKVKCIQSLEKKNNNIAKEFATLQSNFQQEKIHNKEKENNICKKL
FT                   EEIEKKNEAKIDTEKNIRDSKYQEIISYIEEIKREKKGKNENFQNFVLEEIATIKNGLI
FT                   MESQAREAADDDIVQAVNHYTKALQDSLRLINSN"
     atgttttata ataaagagaa tcataataat aataataaga aaaaagatcc agagacattt        60
     aagaaaaggg acgatagttt tttgatatat aaagaaagca taaagagttt caataataat       120
     catttgtcat cttgcgaaga aaaaaaagat aatataaata ataataaatg taatataaat       180
     tcttttgtgt atacatctga atttgaagag ctatataata aagataaaga ttttttagga       240
     gatataaata atacctataa taaacaaaga aaagaaaatt cgttttatga aaacagtagt       300
     aacctttctc aaaacactga agagtatagt agtaataatt ttgtagcttc tcataatata       360
     aatatcgagg agaaaaattt gaataagaag aaaaaatcaa caaagtataa aaaaaaaaat       420
     aaggaactta ataacgtata tataaagaat aaaagtgaat tgtataaggt tcataaatta       480
     tataataaga gtaatcagca atatataaaa gaacaggaaa aagaaataca agaaaaggaa       540
     gaagtagact tagacgtaga aggagaagaa acagaaataa cacgacaagt atatcaaaaa       600
     aatttagaat ataaagaaaa taaaaaagaa caaaaggaac aaaaaaaaga agaccaagaa       660
     gaagaaaaag aagaagaaaa aggagaagaa gaagaaaaag aagaaaaaga aaaagaaact       720
     tattcaaaac tatataattt ttcatacgaa ttagaaaata acttttttga aaaaaatatg       780
     aataattctc ttaaccttac aagaaataat ataatgaatt tttgtgacta taataaaatg       840
     aataaacctt tttctgaaaa agtaaataaa aattatgtta aaatgaatat gaataatgtt       900
     agtcatgtta atagtatgga taatataaat catgcatata acataaataa gatgaataaa       960
     tttaataata cgagtaatac aaatcatatg gataatacaa atcatacaaa tcatatggat      1020
     aatacaaatc atataaatca tatggataat acaaatcata taaatcatat ggataataca      1080
     aatcatataa atcatatgaa tcatatgggt gatgtaaacc atgtgaataa tatgagcaat      1140
     gttaataaca cacattataa taaccaatcc acacatctta ccaacatgaa acatctgaac      1200
     catataaaca gtatggcgag cctgaacaac gtgcgaaata ataatgatct tatttttaat      1260
     aacgaagaaa tattttttaa ttctaaaaag ataaacatgg ataaaggatc caatgctaag      1320
     aagacaaatc ttgtatataa ttcaaagaaa agcagtaaca tggaatatga aaagaatgaa      1380
     aatatgttat ttaatcaggg agttaaaaaa actcttgata ttaatgagaa atgtataaac      1440
     aacaatacta agataaaaat aaaaagatta tgtgaaaaaa ttgaaggatt tgaaaaagaa      1500
     ataaagaatg aaattttaca aaaaaaaaat gtcgaaaaag aaaaaattta tataattaga      1560
     gaggctatta ataaacttga aaaaaattta aataatgaaa taaaaaaaag aatagaacat      1620
     aatagaaata ttcaaaatat attttcatcg gaaattttaa aagtacaaga aaaaatagaa      1680
     aatgtggtac atgacaaagt atatgaaata gaaaatgcta taaaagtttt gaatgaaaaa      1740
     atcaataata ttagttccaa tatagaaaat gaaaaagtta aatgtataca atctttagaa      1800
     aaaaaaaata ataatatagc aaaagaattt gcaaccctcc aatccaactt tcaacaagaa      1860
     aagatccata acaaggaaaa ggaaaataat atttgtaaaa agctcgaaga aattgaaaaa      1920
     aaaaacgagg caaaaataga cacggagaag aatataaggg atagcaagta ccaagaaatc      1980
     atatcataca tcgaagaaat aaaacgagag aagaaaggaa aaaatgagaa ctttcaaaat      2040
     tttgtactag aagaaatagc aacaataaaa aatgggctga ttatggaatc ccaagcaaga      2100
     gaagcagcag atgatgatat cgtacaagcc gtaaatcatt atacaaaagc attacaggat      2160
     tcgttaagac taataaattc taactaa                                          2187
//

If you have problems or comments...

PBIL Back to PBIL home page