(data stored in ACNUC9543 zone)

EMBL: AL844507.PE313

AL844507.PE313       Location/Qualifiers
FT   CDS_pept        join(1392168..1392299,1392407..1393135)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0832200.1"
FT                   /product="Plasmodium exported protein (PHISTa-like),
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0832200.1"
FT                   /db_xref="GOA:A0A143ZWT9"
FT                   /db_xref="InterPro:IPR006526"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZWT9"
FT                   /protein_id="CZT62763.1"
FT                   /translation="MKFHCVEYYSEENHIQNTTNVRLIRRKFLNLLSITGILLVVVLNN
FT                   IIICDKSETNDAGVFNIYRRNLSETESVEHSGLSNTSEDVELENGLEENNNNNNISCDL
FT                   EGSNSEDEVKYNDVTTKRKCDNINYNDLSKQLTLEELHSVLDDLEKSTTKEDLYNIWNQ
FT                   VLGIAKDGFDGMLTELSYYVEEYLHEYEYERYHYFGGRKPVSMKNVRETWYKSMHDIGE
FT                   ALSSTDVKNTLDFYSFVKSGASIDEMKNFIYEFIKYYDTLKNDLFNTHKKIFTEWMKEL
FT                   QGLEK"
     atgaaattcc attgtgttga atattattct gaagaaaatc acattcaaaa tacaacgaat        60
     gttcgtttaa ttaggagaaa atttttaaat ttgttatcaa ttactggaat attgttggtc       120
     gtagtattaa ataatataat aatatgtgac aaaagtgaaa caaatgatgc aggagtattt       180
     aatatatata gaagaaattt atctgagaca gaaagtgtag aacattcagg attaagtaat       240
     actagtgaag acgttgaatt agaaaatggt ttagaagaaa ataataataa taataatatt       300
     tcttgtgatt tagaaggttc taatagtgaa gatgaagtaa aatataatga tgttacaact       360
     aaaagaaaat gtgataatat aaattataat gatttatcaa aacaattgac actagaagaa       420
     ttacattctg tattagatga tttagaaaaa agtacaacta aagaagatct ttataacatt       480
     tggaatcagg ttttgggtat agctaaagat ggatttgatg gtatgttgac agaattatca       540
     tattatgtag aagaatattt acatgaatat gaatatgaac gttatcatta ttttggaggt       600
     aggaaacctg tatctatgaa aaatgtacgt gaaacatggt ataaatcaat gcatgatatt       660
     ggagaggcac tatcatctac agatgtgaaa aatactcttg atttttatag ttttgttaaa       720
     agtggagcat caattgatga aatgaaaaac tttatatatg aatttataaa gtattatgat       780
     acattaaaaa atgatttatt taatacacat aagaaaatat ttacagaatg gatgaaagag       840
     ctccaaggat tagaaaagta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page