(data stored in ACNUC9543 zone)

EMBL: AL844507.PE32

AL844507.PE32        Location/Qualifiers
FT   CDS_pept        join(208451..208502,208762..208878,208973..209038,
FT                   209150..209218,209296..209449,209549..209742,
FT                   209846..210291)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803300"
FT                   /product="mitogen-activated protein kinase organizer 1,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.145:mRNA"
FT                   /db_xref="GOA:Q8IAN3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAN3"
FT                   /protein_id="CAD51330.1"
FT                   /translation="MNLNVNIETVGKLSEHKACITKIIFSDDENYILSSSLDNKVCLWN
FT                   VNTHLHINTYKDVHKKGINDIALFRDNTKFFSAGNDLYVYLWDTLSNKILNRINVNDKI
FT                   NVIRLSTNEKLLFCSKNNAVNIYDFRERDFKKKNNPLQIFNEAKDWISDFIVDDFEVYT
FT                   CSIDNILRIYDLRMGKLMSYDMKSSILSIDITNDKNYFCVNLIDNTIKLVEKNSGTVLG
FT                   LYKGDINNKHKRNIKLDTKNKYIFSCSHKNEIVVYDIVRSNTINNTIFYENLEYEEDLD
FT                   IYKNTYFQLNIGKPTYYLNVNKNILPENSYIDREKYKSILNKYKYYGKKKKDIDSSDKD
FT                   FQNINNKLVCGDIDGNIHILQLYYT"
     atgaatctaa acgttaatat agaaactgta gggaaattat cagagcataa agcgtgtatt        60
     acaaaaataa tatttagcga tgatgaaaat tatattctta gctcaagcct agataataaa       120
     gtgtgtctat ggaatgtaaa cactcattta catatcaaca cttataaaga tgttcataaa       180
     aagggaataa atgacatagc tctttttcgt gacaacacga aatttttttc agcagggaat       240
     gatttatatg tttatttgtg ggatacgcta tcaaacaaga tattgaacag gattaacgta       300
     aatgacaaaa taaatgtaat aagattaagt acgaatgaaa aattactctt ctgcagtaaa       360
     aataatgccg ttaatattta tgactttaga gaaagggatt tcaaaaaaaa aaataatcca       420
     ttacaaatat ttaatgaagc aaaagattgg atatcagatt ttattgttga cgattttgaa       480
     gtatacacat gcagcatcga taatatactt agaatttacg acttaaggat ggggaaatta       540
     atgagttatg atatgaaatc atcaatttta agtattgaca taacaaatga caagaattat       600
     ttttgtgtca atttgattga caatactata aaactcgtgg agaaaaatag tggaaccgtt       660
     ctagggttat ataaaggaga tataaataac aaacataaaa gaaatatcaa gttggacacg       720
     aaaaacaaat atattttttc ctgttcacat aaaaacgaaa tagtagttta cgatattgtc       780
     agaagtaata caattaacaa cacaattttt tatgaaaatt tagagtatga agaagatctt       840
     gacatttata aaaatactta ttttcaatta aatataggta aaccaaccta ctatttaaat       900
     gttaataaaa atattctccc agaaaattca tatatcgata gagaaaaata taaatctatt       960
     ttaaataaat acaaatacta tggaaaaaaa aaaaaagata ttgattcttc agataaagat      1020
     tttcaaaata ttaataataa attggtatgt ggtgacatag atggtaacat acatatattg      1080
     cagttatatt acacttag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page