(data stored in ACNUC9543 zone)

EMBL: AL844507.PE328

AL844507.PE328       Location/Qualifiers
FT   CDS_pept        complement(join(1435794..1437158,1438005..1443449))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0833500"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0833500"
FT                   /db_xref="GOA:A0A143ZZY8"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZZY8"
FT                   /protein_id="CZT62778.1"
FT                   /translation="MAQGGRGGQVGGDDYSDAKHLLDSIGKKVHDEIVKKDAKTYIGEL
FT                   AGLLSQASIFGGETVAFSEPCGLIKNESQKLAALGDPCGSASEKRFSKERVDEYDKKKI
FT                   KCSNSEGACAPYRRLHVCDKNMVKMDTNNDSKAKHDLLLDVCLAAKYEGESLKTYRAQY
FT                   DEQYPSSVSTFTMCTMLARSFADIGDIVRGRDLYRGNRKKNETKTEREKLDDKLKEIFE
FT                   NIRKENNSKLKSLTDDQIREYWWTANRNDVWKAITCSADKGNTYFRATCIDLNESPSMA
FT                   RDKCRCKDKSFTKETDQVPTYFDYVPQFLRWFEEWAEDFCRKKKKYVDIVKTYCRNETK
FT                   GKYCSLNGYDCTKTKPAIGRLRMGNQCTKCFFACYPYEKWIDKKKEEFLKQKQKYEKEM
FT                   EKYTNEASGSTGGRAKRSVSTTNYDGYESKFYKILKDKYKDEGLNKFLEKLSNEDVCTK
FT                   VDDEGGKIRFEKVNSGGTARSGGTSGTSSTSGDSGTNDINNKTFYRSKYCQPCPLCGMK
FT                   RTKNGGNKWEEKSGGNCKSGKLYRPKGGKDVTPIRILKSGENHDDIEEKLNAFCQAQNG
FT                   TGGVANGSGSGTSDSQKLYQEWKCYQLEELTKVVQDGVEDEDDEDDEVYDKEVEGAGGL
FT                   CILKKKKEKSEGKSQNDPDEIQKTFHNFFYYWVAHMLKDSIHWRTKKLDKCLQNGKKKC
FT                   GKKICNGDCDCFKRWVEQKRKEWDPIKKQFSKQKGIPFGCYFTTLEGVLQLEFLNENTD
FT                   EDAENNVSAEEAKEIQHLRQMLKQAGVAIGLDALGGCGTGGDSDNEKETLMDKFLEEEE
FT                   QFAEKCIKKCQETQKQPTGDGVADTSPDPSRDTNVDPEQEEEEEEDDSEEQDATVNGPE
FT                   DGGGEATQQPQGPSEKKEEVKVCETVKTALGGNLDEACNQKYGLPQRHWGWKCIPSGSG
FT                   STATREGEGSSDGGAKDGVGVNGGVLQRARRGTPGEKTATSSDSGAICVPPRRRRLYVT
FT                   PLTRLAGGDKDTQASVSPQVVGETPQVSTPALTSPPPSDPRADVDLVKAFVESAAVETF
FT                   FLWDRYKKEWEHRNKKPQDGLLLFGESTASDHMAALSHTGGPQQQPGSVSDDPQSKLQK
FT                   SGEIPTDFLRQMFYTLGDYRDICIGGDRDIVGDTIVSNTEGGTPTKISEKIEQILSKQS
FT                   GTHPPTPPGPPQTSVEKTTRESWWNAHAPSIWKGMICALTYKDGEEGKSPQVDTTVQKE
FT                   LLDKDGKPLNPQYQYTNAKLEEKNSGAKQNRNPTAPSDNKPTTLVDFISRPPYFRYLEE
FT                   WGENFCKERKKRLKQIKVECKVDQDNDKNGKKCSGYGEDCHDNVFNNNYTTFPDFYCPD
FT                   CGKYCSSYRKWIERKGKEFIKQKNAYKEQKTNFQTQSETAKEFLQKLGSCKNNNRNENA
FT                   EDNNKIFEDNGDTFEPAKDCKPCSQFRVKSEKCNCRSSGKGNTCNDKNSIDVNDIGDGG
FT                   NSTVLEMRVSDDSKSGSGFDGLGECKEAHIFKGIRKDVWTCEKVCGYNVCKPIKVDGKE
FT                   NGENQIIIIRALFKRWLEYFLEDYNKIRKKLKPCKKNGEGSPCIKDCDKICECVTKWIE
FT                   KKRTEWTNIKKHYLEKKHEKGDDGMTSLVKNFLEDLQDRPEFQNAIKPCNDLNAFEKSC
FT                   GLHGAEISQKKEGEDYDLVLCLLKKLEEKAKKCKEDHSSGEQTEKECQEYPPLPDEEYE
FT                   NEDENEKTNIQPKFCPKQQTPPKQEDEDGCVPAEAPKEVVPEKKVPSDPPPAPAPAAPP
FT                   STPAAPKHPRGGEEKKAKPSLPNPPTVFDNPHVKTALVTSTLAWSVGIGFAAFTYFYLK
FT                   KKTKSPVDLLRVLDIHKGDYDIPTKLSPNRYIPYTSGKYRGKTYIYLEGDSGTDSGYTD
FT                   HYSDITSSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSGNNTTASGKNTTASGKTQS
FT                   GNNTTASGKNTPSDTQNDIQNDGIPSNKFSDNEWNTLKDDFISNMLQNEPNTEQNMLGY
FT                   NVDNNTHPTMSRDNMEEKPFITSIHDRDLYTGEEYNYNVNMSTNNVDIPMSDKNGNYTG
FT                   IDLINDTLSGNHNVDIYDELLKRKENELFGTNNPKRTSTYSVAKNTNSDPILNQINLFH
FT                   TWLDRHRDMCEQWDTNNKKEELLDKLKEEWENETHSGNTHPSDSNKTLNTDVSIQIHMD
FT                   DPKTTNEFTYVDSNPNQVDDTYVDTYPNNSSMDTILEDLEKYKEPYYDVQDDIYYDVND
FT                   DHDTSTVDSNNMDVPSKVQIEMDVNTKLVKEKYPIADVWDI"
     atggcgcaag gaggtagggg tggtcaggtt ggtggggatg actacagtga tgccaagcat        60
     ttattggata gcatagggaa aaaagtacac gacgaaatag tgaaaaagga tgctaaaact       120
     tatattggtg aattggcagg actgttgtca caagcatcaa tttttggtgg ggaaacagtt       180
     gccttctcag aaccgtgcgg acttataaaa aatgaaagtc agaaacttgc tgctctcggt       240
     gatccgtgcg gaagtgcaag tgaaaaacgt ttttctaaag aacgtgtcga tgaatatgat       300
     aagaaaaaaa taaaatgtag taatagtgaa ggagcttgcg ctccatatag acgattgcac       360
     gtatgcgaca aaaatatggt aaaaatggac acaaataatg atagtaaagc taaacatgat       420
     ttattgttgg atgtgtgtct tgcagcaaag tatgaaggag agtcattaaa aacatatcgt       480
     gcacaatatg atgaacaata tccttcttct gtttctactt ttacaatgtg tactatgtta       540
     gcacgaagtt ttgccgatat aggtgatatt gtcagaggaa gagatttgta tcgtggcaat       600
     agaaagaaaa atgaaacaaa aacagaaaga gaaaaattag atgataagtt gaaagaaatt       660
     ttcgaaaaca ttaggaaaga gaataattca aaacttaaat cccttacaga tgaccaaatt       720
     agggaatatt ggtggactgc taatagaaac gatgtatgga aagctatcac atgtagcgcg       780
     gacaagggta atacatattt tcgagcaacg tgcattgatc ttaatgaaag tccatctatg       840
     gctagagaca aatgccgctg taaggacaaa agcttcacaa aagagaccga ccaagtcccc       900
     acatatttcg actacgttcc gcagtttctt cgctggttcg aggaatgggc agaagatttt       960
     tgtcgtaaaa agaagaaata tgttgatata gttaaaacat attgtcgtaa tgaaacaaaa      1020
     ggaaaatatt gtagtttgaa tggctacgat tgcacgaaaa ctaaaccagc gattggtaga      1080
     ttgcgtatgg gtaatcaatg tactaaatgt ttttttgcat gttatcctta tgaaaaatgg      1140
     atagataaga aaaaagaaga atttctaaaa caaaaacaaa aatacgaaaa agaaatggaa      1200
     aaatatacaa acgaagcatc aggtagtact ggtggtaggg caaaacgatc tgtaagtact      1260
     actaattatg atggatatga aagtaaattt tataaaatac ttaaagataa atataaggat      1320
     gagggcctta ataaattttt agaaaaatta agtaatgaag atgtatgcac aaaagttgac      1380
     gacgaaggag gaaaaattcg ttttgaaaaa gttaatagtg gtggtactgc tcgtagtggt      1440
     ggtactagtg gtactagtag tactagtggt gatagtggta ccaatgatat taataataaa      1500
     acattttatc gttcaaaata ttgccaaccc tgtcctctat gtggaatgaa aaggaccaaa      1560
     aatggtggta acaaatggga agagaaaagt ggtggcaact gcaagagtgg aaaactttat      1620
     aggcctaaag gtggcaaaga tgttactcct attagaatcc ttaagagtgg tgaaaaccat      1680
     gatgatattg aagaaaaatt aaacgcattt tgccaagcac aaaatggtac tggtggtgtt      1740
     gcaaatggta gtggtagtgg cactagtgat agtcagaaac tgtatcaaga atggaaatgt      1800
     tatcaacttg aagagctgac gaaagttgtt caggatggtg tggaggacga ggatgacgag      1860
     gatgacgagg tctatgacaa ggaggtagaa ggcgcaggcg gattatgtat attaaaaaaa      1920
     aaaaaagaaa aaagtgaagg caaatctcaa aacgaccctg atgaaatcca aaagacattc      1980
     cataattttt tttactattg ggtggcacat atgttaaaag attccataca ttggagaaca      2040
     aaaaaacttg ataaatgttt acaaaatggt aagaaaaaat gtggaaaaaa aatatgtaat      2100
     ggtgattgtg attgttttaa aagatgggtt gaacaaaaaa gaaaagaatg ggacccaata      2160
     aaaaaacaat ttagcaagca aaaaggtatt ccatttgggt gttatttcac aactcttgaa      2220
     ggtgttttac aattagaatt tttgaatgaa aatactgatg aagatgccga aaataatgtg      2280
     agtgcagagg aggcaaagga aatacaacac cttcgccaaa tgttgaaaca agcaggtgtt      2340
     gctattggtc ttgatgctct tggtggctgt ggtaccggtg gtgactccga caatgaaaaa      2400
     gaaactttaa tggataaatt tctcgaagag gaagaacaat ttgccgaaaa atgcataaaa      2460
     aaatgccaag aaacgcaaaa acaacccact ggagatggtg ttgccgacac ctcacccgac      2520
     ccctcacgtg acaccaacgt tgaccccgag caggaggaag aagaagaaga agacgactcc      2580
     gaagagcagg acgccacggt gaacggaccg gaggacggag ggggggaggc aacacaacaa      2640
     ccacagggac catcggaaaa aaaagaggaa gtaaaggtgt gcgaaacagt gaaaaccgca      2700
     ctcgggggca atttggatga agcatgtaac caaaaatatg gtctaccaca acgacattgg      2760
     gggtggaagt gcataccaag tggtagtggt agtactgcca caagggaggg tgaaggtagt      2820
     agtgatggag gtgctaagga tggtgttggt gtaaatggtg gtgttctcca acgtgcccga      2880
     cgtggtacac ctggtgagaa aaccgccaca tctagtgata gtggcgccat ttgtgtgcca      2940
     ccgcgaagac gacgattata tgtcacacca ctaacgagat tggcaggtgg tgataaagac      3000
     acgcaggcgt cagtgtcacc acaggtggtt ggtgagacac cacaggtttc cactccggcg      3060
     ttaacttcgc cgccgccgtc tgacccacgc gccgacgtcg acttggttaa agccttcgtg      3120
     gaatcggccg cggttgagac gttttttttg tgggataggt acaaaaaaga gtgggaacac      3180
     aggaacaaga agccacagga cggattacta ctattcggcg agtcaacagc atcagatcat      3240
     atggcagcac taagtcacac cggtggacca caacaacaac ccggttcagt cagtgatgat      3300
     ccccaatcca aattacaaaa aagtggtgaa atccccacag atttcttgcg acagatgttt      3360
     tatacattag gtgattatag ggatatatgc ataggtggtg accgcgatat cgtgggcgac      3420
     actattgtta gtaacacaga gggtggtacc cctacaaaaa tatcggagaa aatagaacaa      3480
     attttaagca aacaaagtgg cacacatcct cccacacctc ctggtccccc acaaactagt      3540
     gtcgaaaaaa ccacacgaga atcctggtgg aatgcacacg ccccttccat ttggaaaggc      3600
     atgatatgtg ctttaacata caaagatggc gaagagggca aatcaccaca agtggatacc      3660
     actgtgcaaa aggaactttt ggataaagac ggcaaacccc taaaccccca ataccaatac      3720
     acaaatgcca aactcgaaga aaaaaacagt ggtgccaaac aaaaccgaaa ccccacagcc      3780
     cctagtgata acaaacccac caccctcgtc gactttattt ctagaccccc ctatttccga      3840
     taccttgaag aatggggaga aaatttttgt aaagagagga aaaagaggtt gaaacaaatt      3900
     aaagtggagt gtaaggtgga tcaagataat gataaaaatg gtaaaaaatg tagtggttat      3960
     ggggaagatt gtcatgataa tgtttttaat aacaattata ctacttttcc ggatttttat      4020
     tgtccagatt gtggtaaata ttgtagttct tatagaaaat ggatagaaag aaagggaaaa      4080
     gaatttatta aacaaaaaaa cgcatataag gaacaaaaaa caaatttcca aacgcaaagt      4140
     gagactgcta aagaattttt acagaagtta ggatcatgta aaaataataa tagaaatgag      4200
     aatgcagagg ataataacaa aatttttgag gataatggcg atacatttga acctgcaaaa      4260
     gattgtaaac catgttctca atttagagtt aaatcagaaa agtgtaattg caggagttct      4320
     ggtaaaggaa atacctgcaa tgataaaaat agtattgatg taaatgatat tggagatgga      4380
     gggaattcta ctgtactaga aatgcgtgtc agtgatgata gtaaaagtgg aagtggattt      4440
     gatggtttag gcgaatgtaa agaagcacat atctttaaag gtattagaaa agatgtatgg      4500
     acttgtgaaa aggtatgtgg ttataatgtg tgtaaaccga taaaagtcga tgggaaagaa      4560
     aatggtgaaa accaaattat aattattaga gcattattta aacgatggct agaatatttt      4620
     ttagaagatt ataataaaat tagaaaaaaa ttaaagcctt gtaagaaaaa cggtgaagga      4680
     tctccatgta taaaagattg tgataaaata tgtgaatgtg taactaaatg gatagaaaag      4740
     aaaaggacag aatggacaaa tataaaaaaa cattacctag aaaaaaaaca tgaaaagggt      4800
     gacgatggca tgacttcttt ggttaaaaat tttttggaag acttgcaaga tcgacctgaa      4860
     tttcaaaacg ctataaaacc ttgtaatgat ttaaatgcgt tcgagaagtc ttgtggtctt      4920
     catggcgctg agatctcaca aaaaaaagaa ggtgaagatt acgatcttgt tctatgttta      4980
     cttaaaaagc ttgaagaaaa agcaaaaaag tgtaaagagg accactctag tggcgaacaa      5040
     acagaaaaag agtgtcaaga ataccctccc ttacctgacg aagagtatga aaatgaagac      5100
     gaaaatgaaa aaacaaacat acaacctaaa ttttgtccaa aacaacaaac accaccaaaa      5160
     caagaggatg aagacggttg tgtcccagca gaagcaccta aagaagtagt acctgagaaa      5220
     aaagtgccat ctgatccacc cccggcaccg gcccctgcgg cccctccatc aacccctgca      5280
     gcaccaaaac accctcgtgg tggtgaagaa aaaaaagcaa aaccgtcatt accaaacccc      5340
     ccaactgtgt tcgacaaccc ccatgttaaa actgcccttg tgacctccac cctcgcctgg      5400
     agcgttggca tcggttttgc tgcattcact tatttttatc taaagaaaaa aaccaaatct      5460
     cctgtggacc tcttacgtgt acttgatatc cacaaaggtg attatgatat accgacaaaa      5520
     ctttcaccca atagatatat accttatact agtggtaaat acagaggcaa aacatacatt      5580
     taccttgaag gagatagtgg aacagatagt ggttacaccg atcattatag tgatattact      5640
     tcatcttccg aaagtgaata tgaagaattg gatattaatg atatatatgt accaggtagt      5700
     cctaaatata aaacgttgat agaagtggta ctagaaccta gtggtaacaa cacaacagct      5760
     agtggtaaaa acacaacagc tagtggtaaa acacaaagtg gtaacaacac aacagctagt      5820
     ggtaaaaaca cacctagtga tacacaaaat gatatacaaa atgatggtat acctagtaat      5880
     aaatttagtg ataatgagtg gaatacattg aaagatgatt ttatatctaa tatgttacaa      5940
     aatgaaccaa atacagaaca aaatatgtta ggttataatg tggataataa tacccatcct      6000
     accatgtcac gtgataatat ggaagaaaaa ccttttatta cttctattca tgatagagat      6060
     ttatatactg gagaagaata taattataat gttaatatga gtactaataa tgttgatatt      6120
     ccaatgagtg ataaaaatgg taactatact ggtatagatt taattaatga cacgttaagt      6180
     ggtaaccata atgttgatat ttatgatgaa ttgttgaaaa gaaaagaaaa tgaattattt      6240
     gggacaaata atccaaaacg tacaagtaca tatagtgttg caaaaaatac aaacagtgat      6300
     cctatactca atcaaataaa tttgtttcat acatggttag atagacatag agatatgtgc      6360
     gaacagtggg atacaaacaa taaaaaagag gaattgttag ataaattaaa agaagagtgg      6420
     gaaaatgaga cacatagtgg taacactcac cctagtgata gtaacaaaac gttaaatact      6480
     gacgtttcta ttcaaataca tatggatgat cccaaaacta caaatgagtt tacatatgtg      6540
     gatagtaacc ccaaccaagt ggatgacacc tacgtggata cataccctaa taattcttcc      6600
     atggatacta tcttggagga tctggaaaaa tataaagaac cttattatga tgtgcaagat      6660
     gatatttatt atgatgtaaa tgatgatcat gatacatcaa ctgtggatag taataatatg      6720
     gatgttccta gtaaagtaca aattgaaatg gatgtaaata ccaaattggt gaaagagaaa      6780
     tatcctatag cagatgtatg ggatatataa                                       6810
//

If you have problems or comments...

PBIL Back to PBIL home page