(data stored in ACNUC9543 zone)

EMBL: AL844507.PE35

AL844507.PE35        Location/Qualifiers
FT   CDS_pept        join(223762..224639,224779..224835,224935..225387,
FT                   225531..225567,225692..225781,225876..225977,
FT                   226093..226125,226257..226396,226525..226614,
FT                   226765..226784,226890..226954,227063..227112,
FT                   227193..227329,227470..230043,230136..230209)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803600.1"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803600.1"
FT                   /db_xref="GOA:A0A146M1U1"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR040147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146M1U1"
FT                   /protein_id="CZT62743.1"
FT                   /translation="MIIVNEIRHIKNITFLMDFYVVKINNFIKVIQHLLFLEKQRDKYV
FT                   YYITRTNKNKNKNKKVKNVNTTTNSNEKNNEKNDKNNENNDKNNDNVTDDHCGHHECDD
FT                   LEGRHKIQQILYNIKNMKKKRIKKNVLLDFYTQILTIHRRDQPNLINYYVTLINKLKTF
FT                   KYNIQLKKIFIQNVIKEINKEYNSFLIDLHYMYFKVKKEVSNINNYDNNNEGHEIPSIA
FT                   FNTSHNKHIYVYKSIGHVYKNILKTLKLRLEVFLNYIYNLCNNIYKKINIYMANVFSMF
FT                   IDTQEGLFSLMSKRKEYLKEIIKIISAQDNSEHVKNRISCDTLLNTFNNNDIEEDGFEK
FT                   YNLKNNQNMNNDEYTNHYMSQKKYTFTKLNYITSFYENNYYGHENNNVRRDSNYFQNEQ
FT                   ENINESGHINNVEDNINGKKKEQEDQNKDNNNENNNNDNENNNNDNENNNNDNNNDNND
FT                   NNVVKPRMKKEVITIKNIIMFFKRFKGYFKLCRKNMYELSPSLMIKEGEVLHELVVRLL
FT                   NHYTSIININKFFYKSFKKNIYNFNLPVQENKMIYILKEIYLLLHFHITHIWITIKEHT
FT                   EELKNIKNKITQENNFFDIFISYVIKNLGTGDMTPELFEKIKNVEKKITNGKESSRSIS
FT                   LYKWRSLIKINTEIDLKHGGEVSILQILSFPYDEFFNELIEENYNEENIFKKSSLEMYK
FT                   IYSKYCYSTNRKEVKECVGVHLNRTCLYQENNFIHKVLQFLQAKKCSHICMLSIEQNNI
FT                   LTSSNILVNIFNKKNERDKQFAFNLIVHYFIREKGKDTCEIHDTDKNITQTKNQHMHDQ
FT                   VSYDNSAIPILDIQKIISEKNESEDEIKSMHSLLNDDKTKNMDDNQEHKENSILFKDDI
FT                   SNQEIKLSDEESTFEDMNIEVLNMIKKIYEEREKKKLERKRKREKKRKKKKKEKKKTEA
FT                   TLQNLQDIHNKQNVHNVQDIHNKQNTHNVQDIHNKQNIHNVQDIHNKQNTPSVQDTHNN
FT                   DSKSIMSPDFNNDTNKKRETHINNNIPNPNDGRNEDKTTILDEKRKLEESQNEEKNKCP
FT                   ILEIDDHIFEINDKDHLNYIMRSSMNTFNCALSKKILIQGKIFITMDGIYFISLFNSLF
FT                   SKNTILKIKYVDIVSVEKLTILHFLANSIKIITKYKSFVFTSFVHRNHCYNLIMDMIYE
FT                   NNNTHIIPKKGTVIIDRYHEYDTDEKNDLSDEVDNTNDINYHIKEGIHTNDKIYKGDII
FT                   NDYKNNHIIDHYLKDNEMLTDSSKIKNDFPTNIENNKTKNNITNGKCPILHVSNYTKDN
FT                   NLIYVETINKHLPLNIDTEENEILKNNNFINCTNYIDSLFINRNFKDIFLDIYSNLQNQ
FT                   YNPLLKSVLDKKPLNLSYEHIKDIKDLMYNKTFLTYTTEYNILLFNNETKLIGLPDRSN
FT                   VKEIFMFFFFKNNIIIQKIITLLSNIPLAGSFNTIVTLNIHNVMNQNTNNYYTQIDFSY
FT                   DIEFVKSTFFKNHIKNNALPRLEKSIKDLKDYTKEAILQIYQNYDNQTINNNHVNPHQQ
FT                   NNMNQKNKSQKYQSFTFKNNIHIAKTDLQHMTINELREYFKHDFKSVDHLSSYTPLMYF
FT                   LIVSITAFVIYKLLDVKYHF"
     atgattattg ttaatgagat tcggcatatt aaaaacatca ccttcctaat ggacttctat        60
     gtcgtaaaaa taaataattt cataaaagtt attcaacact tgttgtttct ggaaaaacag       120
     agagacaaat atgtatatta tataacaaga acaaataaaa ataagaataa gaataagaaa       180
     gtaaaaaatg taaatactac tactaatagt aatgaaaaaa ataatgaaaa aaatgacaaa       240
     aataatgaaa ataatgacaa aaataatgat aatgttacag atgatcattg tggtcatcac       300
     gagtgtgatg atcttgaggg aagacataaa atacaacaaa ttctatacaa cattaaaaat       360
     atgaaaaaaa aaagaatcaa aaaaaatgta ctcctagatt tttatacaca aattcttaca       420
     atccacagaa gagatcaacc taatttaata aattattatg taacgcttat taacaaatta       480
     aaaactttta aatacaatat acaattaaaa aaaatattta tacaaaatgt aataaaagaa       540
     ataaataaag aatataattc ctttctaata gatttacatt acatgtactt taaagtaaaa       600
     aaagaggttt ctaatattaa taattatgat aataataatg aaggtcatga aataccttct       660
     attgctttta atacttcaca caacaaacac atatatgtgt ataaatccat agggcatgtt       720
     tataaaaata ttttaaaaac attaaaatta agattagaag tcttcttaaa ttatatatac       780
     aatctttgta ataatattta taaaaagata aatatttata tggccaatgt attttccatg       840
     ttcatagata cacaggaggg attattcagc ttaatgagta aaaggaagga atatttaaag       900
     gagatcataa agattataag tgcccaggac aacagtgagc atgtgaaaaa cagaatatcg       960
     tgcgatacac tattgaatac atttaataat aatgatattg aagaagatgg ttttgaaaaa      1020
     tataatctta aaaataatca gaatatgaat aatgatgagt atacgaatca ttatatgtca      1080
     cagaaaaaat atacatttac taaattaaac tatataacaa gcttttatga aaataattat      1140
     tacggacacg aaaataataa tgtaaggaga gattcaaact attttcagaa cgaacaagag      1200
     aatattaatg agagcggtca tataaataat gtggaagata atataaatgg aaagaagaaa      1260
     gaacaggaag atcaaaataa agataataat aatgaaaaca ataataatga taatgaaaac      1320
     aataataatg ataatgaaaa caataataat gataataata atgataataa tgataataat      1380
     gtagtaaaac cacggatgaa gaaggaggtt ataaccataa aaaatattat tatgtttttt      1440
     aaaagattta aaggatattt taaattatgc aggaaaaata tgtatgaact gtctccttcc      1500
     cttatgataa aagagggaga agtactacat gaacttgttg tccgtttatt aaatcattat      1560
     accagtataa taaatataaa caaatttttt tataaatcct ttaagaaaaa tatttataat      1620
     tttaatctcc ctgtacaaga aaacaaaatg atatatatac ttaaggagat atatttatta      1680
     ttacatttcc atataactca catatggata actataaaag aacatacaga agaattaaaa      1740
     aatataaaaa ataaaataac acaagaaaat aatttcttcg atatatttat atcatatgta      1800
     attaaaaatt taggcacggg agatatgacc cccgaattat ttgagaaaat taaaaatgta      1860
     gaaaagaaaa taacaaatgg aaaagaatcg agcagatcaa tttccttata taagtggaga      1920
     agtttgatta aaataaatac cgagatagat ttgaaacatg gaggggaagt atctatatta      1980
     cagatcttgt catttccata tgacgaattt ttcaacgaac ttattgaaga aaattataat      2040
     gaagaaaata tatttaaaaa gtcatctttg gagatgtaca aaatatattc caagtattgt      2100
     tattctacta atcgaaaaga agtgaaagaa tgtgtgggtg tgcacttgaa taggacgtgc      2160
     ttataccagg aaaataattt tattcacaaa gttctacaat ttttacaagc caaaaaatgt      2220
     agccatattt gtatgctcag cattgaacaa aataacattc tcacaagctc aaatattctc      2280
     gtcaacattt ttaacaagaa aaatgaaaga gataaacaat ttgcttttaa tttaattgtt      2340
     cattatttta taagggaaaa aggaaaggat acttgtgaga tacatgatac tgataaaaat      2400
     attacacaaa caaaaaatca acacatgcat gatcaggtaa gttatgataa ctctgccatt      2460
     cctattcttg acatacaaaa aatcataagt gaaaaaaatg aaagtgagga tgaaatcaaa      2520
     agtatgcata gtcttcttaa tgatgataaa acaaaaaata tggatgataa tcaggaacac      2580
     aaagaaaata gtattttatt taaagatgat ataagtaatc aagaaatcaa actctcggat      2640
     gaagaatcca cgtttgaaga catgaacatt gaagttttaa atatgatcaa aaagatatat      2700
     gaagaaaggg aaaaaaaaaa acttgaacgt aaaaggaaaa gagaaaaaaa aagaaaaaaa      2760
     aaaaaaaaag aaaaaaaaaa aacagaggca actttgcaaa atttacaaga tatacataat      2820
     aaacaaaatg tacataatgt acaagatata cataataaac aaaatacaca taatgtacaa      2880
     gatatacata ataaacaaaa tatacataat gtacaagata tacataataa acaaaataca      2940
     cctagtgtac aagatacaca taataatgat agcaagtcaa ttatgtcacc tgattttaat      3000
     aatgacacaa ataagaaaag agaaacacac attaataata atatccctaa tcctaatgat      3060
     ggacgtaatg aggataagac tactatttta gatgagaaaa gaaaattaga agaatcacaa      3120
     aatgaagaaa agaataaatg tccgattcta gaaatagatg atcatatatt tgaaataaac      3180
     gataaagatc atttgaatta tataatgcgt agttctatga atacttttaa ttgtgcttta      3240
     tcaaaaaaaa tattaataca agggaaaata tttattacaa tggatggtat ttattttata      3300
     tctcttttta attccctttt ttcaaaaaat acaatattaa aaataaaata tgtagatatt      3360
     gtatctgttg aaaaattaac aattcttcat tttttagcga actcaataaa aattataaca      3420
     aaatataaat cttttgtatt tacatcattt gtacatcgta atcattgtta taatttaatt      3480
     atggatatga tatatgaaaa taataatact catatcattc ctaaaaaagg aacggttata      3540
     attgacaggt atcatgaata tgataccgat gaaaaaaatg atcttagcga tgaagtggat      3600
     aatacaaatg acattaatta tcatataaaa gaaggtatcc atactaatga taagatatat      3660
     aaaggtgaca taattaatga ttataaaaat aatcatatta tagaccatta tttgaaagat      3720
     aatgaaatgc tcacggactc ttcaaaaatt aaaaatgatt ttcctacaaa tatagaaaac      3780
     aataaaacta aaaacaatat aacaaatgga aagtgtccga tattgcatgt atctaattac      3840
     acaaaggaca acaatctaat ttatgttgaa accataaaca aacacttacc tttaaatatt      3900
     gatacagaag aaaatgaaat actaaaaaat aacaatttta taaattgtac aaattatatt      3960
     gatagtttat ttattaatcg aaattttaaa gatatttttc tagatattta ttcgaattta      4020
     caaaatcaat ataatccatt attaaaaagt gtactcgaca aaaaaccatt aaatttatca      4080
     tatgaacata tcaaagatat aaaagacctt atgtataata aaacattttt aacatacaca      4140
     acggaatata atattttatt atttaataat gaaaccaaat taataggttt acctgataga      4200
     tcgaatgtca aagaaatttt tatgtttttt ttttttaaaa ataatattat tattcaaaaa      4260
     attatcacac ttttaagtaa tataccttta gctggttcat tcaatacaat cgttacatta      4320
     aatatacata atgttatgaa ccaaaataca aataattatt atacacaaat cgatttctca      4380
     tatgatatcg aatttgttaa aagtacattc tttaaaaatc atattaaaaa taatgctttg      4440
     cccagattgg aaaaatcaat taaagatttg aaggattata caaaagaagc tattttacaa      4500
     atatatcaaa attatgataa ccaaacaata aataataatc atgtaaatcc tcaccaacaa      4560
     aataatatga accaaaaaaa taaaagtcaa aaatatcaat cttttacatt caaaaacaat      4620
     atacatatcg ccaagaccga ccttcagcat atgactataa atgaacttcg ggaatatttt      4680
     aagcatgatt ttaaatctgt ggatcactta tcatcatata ctccactcat gtacttttta      4740
     atagtatcca ttacggcatt tgtaatttac aaattacttg atgtaaaata tcatttttga      4800
//

If you have problems or comments...

PBIL Back to PBIL home page