(data stored in ACNUC9543 zone)

EMBL: AL844507.PE37

AL844507.PE37        Location/Qualifiers
FT   CDS_pept        complement(join(233467..234179,234342..234426))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803800"
FT                   /product="proteasome subunit beta type-4"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803800"
FT                   /db_xref="GOA:Q7K6A9"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="PDB:5FMG"
FT                   /db_xref="UniProtKB/TrEMBL:Q7K6A9"
FT                   /protein_id="CAD51325.1"
FT                   /translation="MTLGPVVTGTSVIAIKYKHGIMIAADRKASYGSYAKFQNVERIFK
FT                   INNKTVMGFSGELADAQYLHELLTRKNINNLSEKKRKEDMYTPQHYHSYVSRVFYVRKN
FT                   RIDPLFNNIIIAGINSQKYDNNDDNVLLYTNKNNDDEQNEYKNNEEYKEIHKDDLYIGF
FT                   VDMHGTNFCDDYITTGYARYFALTLLRDHYKDNMTEEEARILINECLRILYFRDATSSN
FT                   FIQIVKVTSKGVEYEEPYILPCVLNSADYVYPSTLLPPAGCMW"
     atgaccttag gcccagtagt aacaggtaca tccgtgatag ctataaaata caaacacggc        60
     ataatgattg cagcagatag aaaagctagc tatggtagtt atgcaaaatt tcagaatgtc       120
     gaaagaattt ttaaaataaa taataagacg gttatgggtt ttagtggtga gctagctgat       180
     gctcaatatt tgcatgagtt acttacacgt aagaatatta ataatttaag tgagaagaaa       240
     agaaaagaag atatgtatac accccaacat taccattcgt atgtaagtag agtattttat       300
     gttagaaaaa ataggataga tcccttattt aataatataa ttatagcagg aataaattca       360
     caaaaatatg ataataatga tgataatgtt ttattatata caaataaaaa taatgatgat       420
     gaacagaatg aatataaaaa caatgaagaa tataaagaaa ttcataaaga tgatttatat       480
     attggatttg tagatatgca tggaacaaat ttttgtgatg attatattac tacaggatat       540
     gctagatatt tcgctctcac attattaaga gatcattata aagataatat gacagaagaa       600
     gaggcacgaa tattaataaa tgaatgctta agaattttat attttagaga tgctacttca       660
     tcaaatttta tacaaatcgt taaggttaca agtaaaggtg ttgaatatga agaaccatat       720
     attcttccat gtgtattaaa ttcagctgat tatgtctacc cttcaacatt acttccacct       780
     gctggatgta tgtggtga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page