(data stored in ACNUC9543 zone)

EMBL: AL844507.PE39

AL844507.PE39        Location/Qualifiers
FT   CDS_pept        242103..244775
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0804300"
FT                   /product="zinc finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0804300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.141:mRNA"
FT                   /db_xref="GOA:Q8IAN9"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAN9"
FT                   /protein_id="CAD51323.1"
FT                   /translation="MNYLKDPYVVNNEHEINRNNCYLHEEEKKYINVEEKHFINVQQKD
FT                   FINVQQKDFINVKQNEFINVKQNEFINVEQKDFLNVEQKDFLNVEECIPQNNNLSSRKR
FT                   YINYNNISGPYNIHNNFYNHYKKQKKHYNATNFYAKNNLFSHNQQNGVYHMNINNRNVS
FT                   NNGCVMNKITKSFEKKKQKKSSSHGLYKHVNDTTTCLLDNQIYEHNNLYLNTDSFVDCE
FT                   QNKNDSKKHRNNKHVRDSEYVYNSEFAQNSDQRVSSLSCENKPINNPVKRSFILNDKNV
FT                   GSGYFLNETIVENMNYHNNKYEDNKNHVSNQFINDTYCNNNNNNNIYVKNETCYNFLPN
FT                   NDTERNEMNSTHAIEREEDIIKHITKYNEEGKRRKKKRNMDILSKDEILKDAVEYFKKC
FT                   SSRNIDNVNYDSSYEEDMKIKNLHHKENMCYVCKEKEHIYKCPYCEICTCSLVCSKNHK
FT                   KMFKCTQKLKKNLKIKNVSKGNFDESILYKDFLYLQNIETIIRGNYKYIKVKNYETTNI
FT                   WLLHNKMLIKLLKKRKIILLKAPIFTKIHKENKTFIYNHILFWTIKITFVNLNIRILHH
FT                   EINENLTFLQIIQYLCSKIEKLQTKIFIYLQNVKSIYVSLNNEQPNKARKNLNHHQNKN
FT                   TNNDNNNACDMKKYCSVQQVLRKSLCGKSFYEYPHFDIEILYEDNKPIVNPLYELEHKK
FT                   EEDNQQNCQQEGSIGNTIRMREGGEDNKEGDEDNKEGDEDNKEGDEHNKEDDKDNKEND
FT                   ENNDEGDENNDEGDEDNDEDDEDNDEDDEDNDEGDEGNDKGDEYNDEGDENNDEGDEDN
FT                   DEDDEDNDEDDEDNDEGDEGNDKGDEYNDEGDEYNDEGDEYNDEGDEYNDEGDEYNDEG
FT                   DEYNDEDDNDMNNNDKNNM"
     atgaattatt taaaagatcc atatgttgta aacaacgaac atgagataaa tagaaataat        60
     tgttacttac acgaagaaga aaaaaaatat ataaatgttg aggaaaaaca ttttataaat       120
     gtacaacaaa aagattttat aaatgtacaa caaaaagatt ttataaatgt aaaacaaaac       180
     gaatttataa atgtaaaaca aaacgaattt ataaatgttg aacaaaaaga ttttttaaat       240
     gttgaacaaa aagatttttt aaatgttgaa gaatgtattc ctcaaaataa taatttatct       300
     tcaagaaaaa gatacataaa ttataataat attagtggac cttataatat acataataat       360
     ttttataatc attataaaaa acaaaaaaaa cattacaatg ctactaattt ttatgcaaaa       420
     aataatttat tttcccataa ccaacaaaat ggggtatacc atatgaacat aaataataga       480
     aacgtttcta ataacggttg tgttatgaat aaaataacga aatcatttga aaaaaagaaa       540
     caaaagaaaa gctcttcaca tggattatat aaacatgtga atgataccac aacgtgttta       600
     ttagataatc aaatatatga gcataataat ttatatttga acactgattc gtttgtagat       660
     tgtgaacaaa ataaaaatga ctcaaaaaaa catagaaata ataaacatgt aagggattct       720
     gaatatgttt ataatagtga gtttgcacaa aattctgatc aacgtgtttc ttctttatca       780
     tgtgaaaaca aacctataaa caatcctgtg aaacgatctt ttatattgaa tgacaagaat       840
     gttggttctg gttatttttt aaatgaaacc attgtggaaa atatgaatta tcataataac       900
     aaatatgaag ataataaaaa ccatgtgagt aatcaattta ttaatgatac atattgtaat       960
     aataataata ataataatat atatgtaaaa aacgagacgt gttataattt tttacccaat      1020
     aatgataccg aaagaaatga aatgaatagt acacatgcta tcgaaagaga agaagatata      1080
     ataaaacata taacaaaata taatgaagaa ggaaaaagaa gaaaaaaaaa aagaaatatg      1140
     gatatattgt caaaagatga aattttaaaa gatgctgtag aatatttcaa gaaatgttca      1200
     tcaagaaata ttgataatgt aaattatgat agttcatatg aagaagacat gaaaataaaa      1260
     aatcttcacc ataaagaaaa tatgtgttat gtttgtaaag aaaaagaaca tatttataaa      1320
     tgtccatatt gtgaaatttg tacatgttca ttagtatgtt caaaaaatca taaaaaaatg      1380
     tttaaatgta cacaaaaatt gaaaaaaaat ttaaaaataa aaaatgttag taaagggaat      1440
     tttgatgaat ccatattata taaagatttt ctctatttac aaaatataga aactataata      1500
     cgaggaaatt ataaatatat caaagttaag aattatgaaa ctacaaatat atggttatta      1560
     cataataaaa tgttaattaa attattaaaa aaaagaaaaa ttatcttatt aaaagctccc      1620
     atatttacaa agatacataa agaaaataaa acattcatat ataatcatat tcttttctgg      1680
     actatcaaaa taacttttgt taatcttaat attagaattt tacatcatga aataaatgaa      1740
     aatcttactt ttttacaaat tattcaatat ttatgttcaa aaatcgagaa attacaaaca      1800
     aaaattttta tctaccttca aaatgttaaa tcaatatatg tatctttgaa caatgaacaa      1860
     ccaaataaag caaggaaaaa tctaaatcat catcaaaata aaaacacaaa caatgataat      1920
     aataatgcat gtgatatgaa aaaatattgc tccgttcagc aagttttgag gaaatcattg      1980
     tgcggaaaat cattttatga ataccctcat tttgatatag aaattttata tgaagataat      2040
     aaaccgattg taaatccttt gtatgagctt gagcacaaaa aagaggagga taaccaacag      2100
     aattgtcaac aggaaggcag tatagggaat acgattcgta tgagagaagg tggtgaggat      2160
     aataaggaag gtgatgagga taataaggaa ggtgatgagg ataataagga aggggacgag      2220
     cataataagg aagatgacaa ggataataag gaaaatgacg agaataatga tgaaggtgac      2280
     gagaataatg atgaaggtga cgaggataat gatgaagatg acgaggataa tgatgaagat      2340
     gacgaggata atgatgaagg tgatgagggt aatgataaag gtgacgagta caatgatgaa      2400
     ggtgacgaga ataatgatga aggtgacgag gataatgatg aagatgacga ggataatgat      2460
     gaagatgacg aggataatga tgaaggtgat gagggtaatg ataaaggtga cgagtacaat      2520
     gatgaaggtg acgaatataa tgatgaaggt gacgaatata atgatgaagg tgacgaatat      2580
     aatgatgaag gtgacgaata taatgatgaa ggtgacgagt acaatgatga agatgacaat      2640
     gatatgaata ataatgataa aaacaatatg taa                                   2673
//

If you have problems or comments...

PBIL Back to PBIL home page