(data stored in SCRATCH zone)

EMBL: AL844507.PE48

AL844507.PE48        Location/Qualifiers
FT   CDS_pept        290902..291183
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805200"
FT                   /product="gamete release protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0119:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAP7"
FT                   /protein_id="CAD51314.1"
FT                   /translation="MSYNGYVPPNEDTPIPYGMSILPGNKDDDVPPNVTYTVGPIINDD
FT                   HFQMNLGGVVPSSWSLNQIAHYIKFAGPDDSVFAEKAKDLLREKGYQI"
     atgtcataca acggttatgt cccaccaaat gaagataccc ctatacctta tggaatgagt        60
     attttaccag gaaataaaga cgatgatgtt cctccaaatg ttacttatac tgttggacca       120
     ataataaatg atgatcattt ccaaatgaac ttaggaggag tggttccatc ttcttggtca       180
     cttaaccaaa tagctcatta cattaaattt gcaggacctg atgatagtgt ttttgctgaa       240
     aaggcaaaag acctcttacg tgaaaaagga tatcaaatat aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page