(data stored in ACNUC9543 zone)

EMBL: AL844507.PE53

AL844507.PE53        Location/Qualifiers
FT   CDS_pept        complement(join(314172..314252,314434..318726))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805700"
FT                   /product="serine/threonine protein kinase, FIKK family"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.203:mRNA"
FT                   /db_xref="GOA:C0H4R8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4R8"
FT                   /protein_id="CAX64094.1"
FT                   /translation="MIRTSEKVEYCKSKTMTCDDDYLSLKSSKTLNIDNGEEEYEKLGN
FT                   ERRDVQNMNDAEDVSLYKNKKYNPKKNVDKNNVDKNNIDKGNVDKSNVDKNNIDKGNVD
FT                   KSNVDKSNVDKSNVDMCEGNNIKSTDRKSNNTKRNSSKYNGLEERDDEDNSNNNNNMNS
FT                   MYDRNMVNTTYYENVQHMISKDDNESFDNYPKESKDLSEKFMNKNMLDNNNNSNNNNNN
FT                   NNNNNTIMNEEDIFMKYIEDTKNNDSSKNFVNDKEFVCTMSKDKYSEMNRSTTEIFDNM
FT                   NCIEYTDEYKQTNNQNFNSTIMMKEDTNKDDIKNVYRNISMDPKDCSGINFNEMNVEED
FT                   NNVVIGNNSNLESYENMGNENYTENIMYRNKKEQDEDEGDNDEEDKNSNNNYNLNDHNN
FT                   NTEEERKKNDTFYKKNGDYKNMLSNQDIYNETENINDSTTECTIVKDVPKCITNNHIQG
FT                   NLLDNTYLPKDVNANFRSYEQVDVKDNNSLLHTPIGCENKNKSYVNFPFNTVENKNIHI
FT                   TMEEEKYRDHNKVHHEIDDNGYIINSRDDAVNNKDSFYKSLSQQIYIDKNGSKYNVDIS
FT                   NDLFKKKCNINDKNMKNNYNENNDILRGAGQNDMPNNMHNISQKGFHLNQEGINDMLRN
FT                   QNNIAFQNSQYNGYIKDEQNIMNNLCERIEPSYIDSTSKRDSEGTKSAVHKNNINRNNN
FT                   NYNGNINKNNNNIHGNRNSNNIHGNRNSNNIHGNRNSNNIHSNRNSNNTHSNRNSNNTH
FT                   SNRNSNNSNRNNYNSFVVPGNMNSNNNDNNDKSYNNDKSYNNDNNYNNDNSYDKSLDEY
FT                   FRNNLPEDIIKNIKYENPSNTYNDLLNNRDYDLISKIKENPVYYSSEKEKKRMKNKDMK
FT                   QPKYVSNEKLDLDEHTHIYKNNNEDNNYNSMNRDTTIISKCDNPEMHYGQGNSYILPTC
FT                   QRNDLLKDDRNPMLSISKQKIKNIWSKFKNNTCKEHNVNRISESKNNNYVHKMEIMNIP
FT                   KKGLGNEYYNYPYDNNNNNNNINNNNNNINNNSNSNNIINNKECINKPIIYMNHINNNN
FT                   MDKQMRPKCIFNWKIAKKSLMKMLHSAHNFYFNGVKYSDWKFTCIPTLGFSKSSNRVQQ
FT                   MYRAFVVPKDSNVKKEVKLFIKKIPIYIWVKQFNLMNEYDGEYVTDGENFVMEATALAF
FT                   LNEYHPGITPKLYKILYEPDNKYFNEGLSQKSMYNNLNVFNDMLSERLKCNVGGNIVIV
FT                   SEFFNEDILDFIDRRQKKYNMKISNNEKSFILYQCLKLLIRLHDAGLSHLDLTPENILI
FT                   SDNYELRFCDLSKSTPIYTYNLRHIKDMNRLYLFESCEPTIAKGAYMPPECWKIYWKYD
FT                   TMKIKNPLKDLKHITDQEKRKQFYFDVSNADKFMLGVFFFWIWTNGNLWKCSDPLQDED
FT                   FFYFVKCDMNFDNFELTKNWPNELKDIIKQLLHVEQRKKLNLKDLSAHPWWSFKL"
     atgataagaa ctagcgaaaa ggtggagtat tgcaaatcca aaaccatgac ttgtgatgat        60
     gattatttat cattgaaatc ttcgaagacc ctaaatatag ataacggaga agaagaatat       120
     gaaaagttag ggaatgaaag aagagatgta caaaatatga atgatgctga agatgtgtca       180
     ttatataaaa ataagaaata caatccaaaa aaaaatgttg ataaaaataa tgttgataaa       240
     aataatattg ataaaggtaa tgttgataaa agtaatgttg ataaaaataa tattgataaa       300
     ggtaatgttg ataaaagtaa tgttgataaa agtaatgttg ataaaagtaa tgttgatatg       360
     tgtgagggaa ataatattaa aagtactgat agaaaaagta ataatacaaa aagaaactca       420
     tcaaaatata atggtttaga agaaagagat gatgaagata atagtaataa taataataat       480
     atgaatagta tgtatgatag aaatatggtg aatacaacat attatgaaaa tgtgcagcat       540
     atgatttcta aagatgataa tgagtcgttt gataattatc caaaagaatc taaagactta       600
     tctgaaaagt ttatgaataa aaatatgtta gataataata ataatagtaa caataacaat       660
     aataataata ataataataa tacaattatg aatgaagaag atatttttat gaaatatata       720
     gaggatacca aaaataatga tagctcgaaa aattttgtta atgataaaga atttgtgtgt       780
     accatgtcaa aagataaata ttccgaaatg aacagatcca caacagaaat atttgataat       840
     atgaattgta tagaatatac agatgaatat aaacaaacga ataatcaaaa ttttaatagt       900
     actattatga tgaaggaaga tacaaataag gatgatatta aaaatgttta tagaaatatt       960
     tctatggatc ctaaagattg ttcaggaata aattttaatg aaatgaatgt agaagaagat      1020
     aataatgttg tcattggtaa taattcaaat ttagaaagtt atgaaaatat gggaaatgaa      1080
     aattatactg aaaacattat gtatagaaat aaaaaggaac aggatgaaga tgaaggtgat      1140
     aatgatgagg aagataagaa ttcaaataat aattataatt tgaatgatca taataataac      1200
     actgaagaag aaagaaaaaa aaatgatact ttttataaaa aaaatggaga ttataagaat      1260
     atgttaagta atcaagatat ttataacgaa acggaaaata ttaatgatag taccaccgaa      1320
     tgtacaatag ttaaagatgt gcccaaatgt attacaaata atcatataca gggtaattta      1380
     ttagataata catatttacc taaagatgtg aatgcaaatt tcagaagtta tgaacaagtg      1440
     gatgttaagg ataataattc tttattacat acacctattg gttgtgaaaa taagaataaa      1500
     tcatatgtca attttccttt taatactgta gaaaataaaa atatacatat tacgatggaa      1560
     gaagaaaaat accgtgacca taataaagtt catcatgaaa tagatgataa tggttatata      1620
     ataaattcaa gagatgatgc tgttaataat aaagattcat tttataagag cctttctcaa      1680
     caaatttata tagataaaaa tggtagtaaa tataatgttg acatttcaaa tgatcttttt      1740
     aaaaagaaat gtaatataaa tgataagaac atgaaaaata attataatga aaataatgac      1800
     atattaagag gagcaggtca aaatgatatg cccaataata tgcataatat atcacaaaaa      1860
     ggtttccatt taaatcaaga aggaattaat gatatgttaa gaaaccaaaa taatatagca      1920
     tttcaaaata gtcaatataa tggatatata aaagatgaac aaaatattat gaataacttg      1980
     tgtgaaagga tagaaccaag ttatattgac tcaacgtcca agagagatag tgaagggaca      2040
     aaaagcgctg ttcataagaa taatattaat aggaataata ataattataa tggtaatata      2100
     aataagaata acaataatat tcatggtaat cgaaatagta ataatataca tggaaatcga      2160
     aatagtaata atatacatgg taatcgaaat agtaataata ttcatagtaa tcgaaatagt      2220
     aataatactc acagcaatcg aaatagtaat aatactcaca gcaatcgaaa tagcaataat      2280
     agtaacagaa ataattacaa tagttttgtt gttccaggaa atatgaacag taataataat      2340
     gataataatg ataagagtta taataatgat aagagttata ataatgataa taattataat      2400
     aatgataatt cttatgataa atctttagat gaatatttcc gaaataacct cccagaagat      2460
     attattaaaa acatcaaata tgaaaatcca tccaatacat ataatgattt attaaataac      2520
     agagactatg atttaatttc aaagataaaa gaaaaccctg tgtattattc ttcagaaaaa      2580
     gaaaagaaac gaatgaagaa taaagatatg aaacaaccta aatatgtttc aaatgagaaa      2640
     ttggatttag atgagcatac acatatttat aaaaataata atgaagataa taattataat      2700
     agcatgaata gagatacaac aattatatct aaatgtgata atcctgaaat gcattatggt      2760
     caaggaaatt cttatatact tcctacatgt caaagaaatg atttattaaa ggatgatagg      2820
     aatcctatgt tatctatttc aaaacaaaag ataaaaaata tttggagcaa atttaaaaat      2880
     aatacttgta aagaacataa tgtgaataga atatctgaaa gtaagaataa taattatgtg      2940
     cacaaaatgg aaataatgaa tattccaaag aaaggattag gtaatgagta ttataattat      3000
     ccatacgaca ataacaacaa taataataat attaataata ataataataa tattaataat      3060
     aatagcaata gtaataatat tattaataat aaagagtgta ttaataaacc aataatatat      3120
     atgaatcata tcaataataa taatatggat aaacaaatga gacctaaatg tatctttaat      3180
     tggaaaatag ctaaaaagtc attaatgaaa atgttacata gtgcacataa tttttatttc      3240
     aacggtgtta aatattcaga ttggaaattt acgtgcatac caactcttgg attttctaaa      3300
     tctagtaata gagttcaaca aatgtataga gcttttgttg ttccaaaaga tagtaatgta      3360
     aaaaaggaag ttaaattatt tattaaaaaa attcctatat atatatgggt taaacaattt      3420
     aatttgatga atgaatatga tggagaatat gtaacagatg gagaaaattt tgtaatggaa      3480
     gctacggctt tagctttttt aaatgagtat catccaggaa tcacaccaaa gttatataaa      3540
     atattatatg aaccagataa caaatatttt aatgaaggac tttcacagaa atctatgtat      3600
     aataatttaa atgtttttaa tgatatgcta agtgaaagat tgaaatgtaa tgttggtggt      3660
     aatattgtta tcgtctctga attttttaat gaagatatac ttgattttat agatcgtaga      3720
     caaaaaaaat ataatatgaa aatcagtaat aatgaaaaaa gttttatatt ataccaatgt      3780
     ttaaaattat taatacgatt acatgatgca ggcctatcac atttagattt aacaccagaa      3840
     aatattttaa tctctgataa ttatgaatta cgtttctgtg acttatctaa aagtacaccc      3900
     atctatacat acaatttaag acacattaaa gatatgaacc gtctctattt atttgaatca      3960
     tgtgaaccta ctattgcaaa aggggcatat atgccaccag aatgttggaa aatatattgg      4020
     aaatatgata caatgaaaat aaaaaatcct ctaaaagatt taaagcatat tacagatcaa      4080
     gaaaaacgaa aacaatttta tttcgatgtt tctaatgctg ataagtttat gcttggtgtg      4140
     ttcttctttt ggatttggac aaacggaaat ttatggaaat gttcagatcc attacaagat      4200
     gaggattttt tctatttcgt aaaatgtgat atgaattttg ataattttga gttaacaaaa      4260
     aattggccaa atgagttaaa agatatcatc aagcaattat tacatgtaga acagagaaag      4320
     aagttgaact tgaaagatct aagcgcacat ccatggtggt ctttcaagtt ataa            4374
//

If you have problems or comments...

PBIL Back to PBIL home page