(data stored in ACNUC9543 zone)

EMBL: AL844507.PE54

AL844507.PE54        Location/Qualifiers
FT   CDS_pept        complement(322367..323677)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805800"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805800"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZVZ5"
FT                   /protein_id="CZT62747.1"
FT                   /translation="MTIVPNKCYSYNELTKYTCHHKNKERLYKTRNLIIYSFSVIISWI
FT                   NSMSICDKIVNEYNIYDLIKSGVVLLKIIKIYRPHLEIINIFSKAIKKKCALHNLEKVL
FT                   EVVYKNNPHCYTMVSSIDIYDMKRTKVNLFLIQIFDMFEFQSLKKISTPLLRWYDNSLK
FT                   TFSLRLNERTINDPFYINKEYDKQKYTFQMIEGEYRYKKNNEINDKKEDYDNIKENLLY
FT                   NSEKEVLKDFASYILYKDKEEHEQNKNKIKINNNKYNNDNHRCCSSDGDIPHIVKDFSN
FT                   CIKIFFIFYKYGYILKKELINIFQSDRKNNIFYSLKKLMKKLHIPIVLQNIYLNNPCEV
FT                   VLILQLKYIYNFIMNNDKNLFSNYYIKEKNIYTPHEKKLYLNYEEETNKKNCIPRNNFV
FT                   HKNKLSLNDNFKKERTEEIRQMFYDKIRKHMKKYDRK"
     atgactattg ttccaaataa gtgttattca tataatgaac ttacgaaata tacatgtcac        60
     cataagaata aggaaaggtt atataaaacg agaaatttaa taatatattc tttctcagtg       120
     attataagtt ggataaatag catgtcaata tgtgataaaa ttgtgaatga atataatata       180
     tatgatctta taaaaagtgg tgtagttctt ttaaaaataa taaagattta taggcctcat       240
     cttgaaatta ttaatatatt ttctaaagca ataaaaaaaa agtgtgcttt acataattta       300
     gaaaaagtgt tagaagttgt ttataagaat aatcctcatt gttataccat ggtatcttca       360
     atagatattt atgatatgaa aaggacaaag gtcaatttat ttttaataca aatatttgat       420
     atgtttgaat ttcaaagctt aaaaaaaata tctactcctt tattacgttg gtatgataat       480
     tcccttaaaa cattttcttt aagattaaat gaaagaacaa taaatgatcc tttttatata       540
     aacaaagaat atgacaaaca aaaatatact tttcaaatga tagaaggaga atatagatat       600
     aaaaagaata acgaaataaa tgataaaaaa gaagattatg ataatataaa agagaactta       660
     ttatataatt ctgagaagga ggtattaaaa gattttgcat cgtatatatt gtataaagat       720
     aaagaagagc atgagcaaaa taaaaataaa ataaaaataa ataataataa atataataat       780
     gataaccatc ggtgttgtag tagcgatggg gatatacccc atattgttaa agatttttct       840
     aattgtatca aaatattttt catattttac aaatatggtt atatattaaa aaaagaactt       900
     ataaatatat ttcaatcaga tagaaaaaat aatatatttt attctttaaa aaaattaatg       960
     aaaaaattac atatccctat tgtcctacaa aatatatatt taaataaccc ttgtgaagta      1020
     gtacttattt tacaactaaa atatatttac aattttatta tgaataatga taaaaattta      1080
     ttttctaatt attatataaa agaaaaaaac atatacacac cacatgagaa aaaattatat      1140
     cttaattatg aggaagaaac aaacaaaaaa aattgcatac caagaaataa ctttgtacat      1200
     aaaaataagt tatcactcaa tgataatttt aaaaaagaaa gaacagaaga aataagacaa      1260
     atgttttatg acaaaattag gaaacatatg aaaaaatatg acagaaaata g               1311
//

If you have problems or comments...

PBIL Back to PBIL home page