(data stored in ACNUC9543 zone)

EMBL: AL844507.PE55

AL844507.PE55        Location/Qualifiers
FT   CDS_pept        complement(join(324279..324365,324509..324745,
FT                   324856..324996,325109..325201,325305..325458,
FT                   325618..325655))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0805900"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0805900"
FT                   /db_xref="InterPro:IPR019129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZVL3"
FT                   /protein_id="CZT62748.1"
FT                   /translation="MSYVDLSGYKIPKKMFDELNPFERHKLMMSLRSLEEEKKKENKNE
FT                   KYLSDYDILRKKYNFIHDVENEKNSLLQNYYKSICNKYVICDLSKYKETKIGLRWRTEE
FT                   EIIKGKGHVICSSKKCNNTDLNTYEFLFQYIEQGIKKETNVKVRACMDCAYKLHYRKIN
FT                   KYLKKKEKEKKKKKIKEKKKRKKKKGKKNKSDLTSESDLSSSYNSEDRSQSKREKLYYV
FT                   KKKLEKISIKKKEEMNEDNLFFHDLLF"
     atgagttatg ttgatttaag tggctataaa attccaaaaa agatgtttga tgaactgaac        60
     ccttttgaga ggcataaact tatgatgtct ctccgttcat tagaagaaga gaaaaaaaag       120
     gaaaataaaa atgagaaata tttaagtgat tatgatattt taaggaaaaa atataatttc       180
     atacacgatg tggaaaatga aaagaattct ctccttcaaa attactacaa gagtatatgt       240
     aataaatatg tgatatgtga tttgtcgaaa tataaagaga cgaagatagg gttaagatgg       300
     agaacagaag aagaaataat aaaaggaaaa ggacatgtaa tttgttcatc taaaaaatgt       360
     aacaatacag atttgaatac ctacgagttt ttatttcagt atatagagca aggaataaaa       420
     aaagaaacaa atgtaaaggt acgagcgtgt atggattgtg catataaatt acactacagg       480
     aaaattaata aatatttgaa gaaaaaagaa aaagaaaaga aaaaaaagaa aataaaggaa       540
     aagaagaaaa ggaagaaaaa aaagggaaaa aagaacaaat cggacttaac cagtgaatcg       600
     gatttatctt cgtcgtataa ttcggaggac cgttctcaat caaaacgaga aaaattatac       660
     tatgttaaga aaaagctgga aaaaatttcc ataaaaaaga aagaagaaat gaatgaagac       720
     aatttatttt tccatgattt attattttag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page