(data stored in ACNUC9543 zone)

EMBL: AL844507.PE57

AL844507.PE57        Location/Qualifiers
FT   CDS_pept        330651..332678
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806100"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZXM1"
FT                   /protein_id="CZT62749.1"
FT                   /translation="MVYDEEGKEKGLQKKKKGINKRNTRIFLRDKIKDIEIQCGKLKDY
FT                   LKKKEEEKKIFQISTVLLKQYHSYLNNKLYNNISSCLPIFHHIFVTSCGIIFTNNDCYI
FT                   NDEKKKINQKKKIKNINNHLLYCKNGKSSFSDHCIYDEDICKNISSIYYPMKGKNKSTL
FT                   IKQTNILYEEKENMLCTTLKDQSKKKKSCYVYNIQNNNINNNMYIESMTSENNKKKLKE
FT                   KNIIYLSSLEGKKKKMYKKYRNDQDTSTLYTHNNNNNNNNNKILIKNKKKKCTTIYNEN
FT                   NKSISSTILNTSFNNIKKKKKMDYLNRKFIDKKCSTDKNLIISSSHTVDTISELVNMNN
FT                   SSSDNNISTYNDIHVQNVCNKSNKIKRYNHNNIIKKIKNPTKYEISSSLSILLGCKTNA
FT                   HNYYNDIYDEEYKKKYNHINKMNTQYNEPYNIQYVKEKHKTETETETKTETETKTKAKK
FT                   KKKKKKEKKDESYIDSYIDLIKNVKVFSFFENKEQIIQNNTFTNFFNNIKNFFFFSSND
FT                   KKEQKENNTSDHNNPYEQNKNINNKRQYNILKYQCVIKSKGIKIFLCVCPNCSKHFYLL
FT                   IKKGSQKKMISKVLHPSYFVTLVKNLKKQKINLLKDEYEQMSDDNPSMKNIPYLDITTV
FT                   EFFNDSLYYDETVQDFCQCYLKINETTNNFYDNMDILLYI"
     atggtatatg atgaggaagg aaaagagaaa ggattacaaa agaagaaaaa aggaatcaac        60
     aaaaggaata cacgtatatt tttaagagat aaaataaaag atattgaaat ccagtgtgga       120
     aaattaaagg attatttaaa aaaaaaggaa gaagaaaaga aaatatttca aatatctaca       180
     gtgttattaa aacaatatca ttcgtattta aataataaat tgtataataa tatatcttca       240
     tgtttaccaa tatttcatca tatctttgtt acaagttgtg gaattatttt tacaaataat       300
     gattgttata ttaatgatga aaaaaaaaaa ataaatcaaa aaaaaaaaat aaaaaatata       360
     aataatcatc ttttgtattg taaaaatggg aaatctagtt tctctgatca ttgtatatat       420
     gatgaggata tatgtaaaaa tatatcgtct atttattatc ctatgaaggg aaaaaataaa       480
     agcacactaa taaaacaaac gaatatttta tatgaggaaa aagaaaatat gttatgtaca       540
     actctaaagg atcaatccaa aaaaaaaaaa agttgctacg tttataatat acaaaataat       600
     aatattaata ataatatgta tattgaaagt atgaccagtg aaaataataa aaaaaaattg       660
     aaagaaaaga atattatata tttatcatca ttagaaggga aaaaaaaaaa aatgtataaa       720
     aaatatagaa acgatcaaga cacaagtact ttatatacac ataacaataa taataataat       780
     aataataata aaattttaat aaaaaacaaa aaaaaaaaat gtacaactat ttataatgaa       840
     aataacaaaa gtatatctag tacaatttta aatacttcct ttaataatat taaaaaaaaa       900
     aaaaaaatgg attatcttaa tcgtaaattc attgataaaa aatgttccac ggataaaaat       960
     ttaatcattt catccagtca tacggtagat actataagtg aactagttaa tatgaataat      1020
     tcatcatcgg ataacaatat ttcaacatat aatgatatac atgtacaaaa tgtatgtaac      1080
     aagtccaaca aaataaaaag atataaccat aataatataa taaaaaaaat aaagaatcct      1140
     accaaatatg aaatatcatc cagtttatca atattgttgg gttgtaaaac taacgctcat      1200
     aattattata atgatatata tgatgaagaa tataaaaaaa aatataatca tattaacaaa      1260
     atgaatacgc aatataatga accatataat attcaatatg ttaaggaaaa acataaaacg      1320
     gaaacggaaa cggaaacgaa aacagaaacg gaaacgaaaa cgaaagcgaa aaagaaaaag      1380
     aaaaaaaaaa aagaaaaaaa agatgaaagt tatatagatt catatataga tcttataaaa      1440
     aatgttaaag ttttttcatt ctttgaaaat aaagaacaaa taatacaaaa taatacattt      1500
     accaattttt tcaataatat aaaaaatttt tttttttttt catctaatga taagaaggaa      1560
     caaaaggaaa ataacacatc agaccataat aatccttatg aacaaaacaa aaatataaat      1620
     aataaaagac aatataatat tttaaaatat caatgtgtaa ttaaatctaa aggtataaaa      1680
     atttttttat gtgtttgtcc taattgttct aaacattttt atttattaat aaaaaaaggt      1740
     tcacaaaaaa aaatgatctc taaagtactt catccttctt attttgttac tctagtcaag      1800
     aatttaaaaa aacaaaaaat taatctttta aaagatgaat atgaacaaat gagtgatgac      1860
     aaccccagta tgaaaaatat accttattta gatattacaa cagttgaatt ttttaacgat      1920
     agtctttact atgatgaaac tgttcaagac ttttgtcaat gttatttaaa aataaatgaa      1980
     actacaaata atttttatga taatatggat atattacttt atatttaa                   2028
//

If you have problems or comments...

PBIL Back to PBIL home page