(data stored in ACNUC9543 zone)

EMBL: AL844507.PE59

AL844507.PE59        Location/Qualifiers
FT   CDS_pept        complement(join(337902..337966,338093..338337,
FT                   338450..343254))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806300"
FT                   /product="ferlin-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.134:mRNA"
FT                   /db_xref="GOA:C0H4S2"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR012968"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037721"
FT                   /db_xref="InterPro:IPR037724"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S2"
FT                   /protein_id="CAX64098.1"
FT                   /translation="MSSIAKKTQYNIKVDIHEVKDLSFRESANEKEIIPNPYIEVTVNN
FT                   EKKSTTKKNQAVNVVYNTSFNFSQDLTDYKFERTSVDVCVLHKYTIQSALIGKCSFGLN
FT                   FVYSKVQHWLYRIWVKLRNPDLPLDDVGFLLISVGVYGPGDSIPIVNDSVKTDIHEDVF
FT                   SNKGLDIHITHYDLCLNIFRGQDIELIGNSTLFSNILEPYVKVSHNGFEECTKVIRNDP
FT                   NPVWNLSIHIPTCTPCYDKNILVELINGEHNGIVIYSILLDFFEILKRELAPRWFNIYY
FT                   NPQNQIMPRYSEYMQNGSIQINLNSTTTNNNNNNSTAINPLGNYLFSGAAEKIFKNATQ
FT                   AININDILGVTKVQNMFTDDTLKEFYLYGGRIFLSANATKTHSPGPICIKSAKVEVDAP
FT                   NKEYIFCADIYEILSVRNNKMGNYDDYDGGYTTTNNNNKNKNNNNENNNNDNNDNIYNS
FT                   NNIYNSASEKRRSRYNNNYDASGESIICVCALGPHKLKTIPLLPNEVGSYVLNENVGRI
FT                   DEFRIFLPQNNNEQIYDIFLYIYIKSNLAVTNWINNRRSIYNSVLLNNEYESGDRNKKQ
FT                   GLHKMGSINNISEDIMQDSDFLNNYKLTSYVRIPYKYLLLNENKPKWFSMKNIETNVHE
FT                   YNISFFANLIPYHAYKKRPKRLEYKLSRYFFRALIYEGLHFPAKGYNAFPDPYIKIELA
FT                   GQVIKTSTILHTLNPNYYEAYEVQVILPTNLNLAPDISIEALSVNKSFLYNDDILLGSC
FT                   TFPIMKVPTEWKKSPIWIPLKSSQYKKCKAKLLVAFELVPVEKVLDDTYPFYDDIRPST
FT                   LPGHVSLFLIGIRMFKPLKDPSVTVCFGRDVDDTSQFLWHETTNKVISGKEGNWNFLKY
FT                   FSLDVMLPKRMQHHSFLEVRIEDRILNSGFTGTASSNMHAVNATNNNLLIGTAYITLNP
FT                   LLPWLDNYEKNECVELFKLHLLEEVLIEDAEMDRKSYNSALIYKKSSIMSRKLSNDNFE
FT                   TQQMGEENGIFNDIPMNTLEENVTIKGDDSSDDEKDNSYDDEKDNSYDDEKDNSYDDEK
FT                   DNSYDGDDKSGHYYHTWEDNNNNNNNNVTSDHTCKHKNEHNNNKKEDEKRKREKKNTYT
FT                   TNHDKRENNNTHINNNYKHVIDIKKKKRKKNIKKYINNEYVPYNDPDFSNVRIEETLEH
FT                   VCFKINDLTKKENTYIYYNDEQETLCDSISSEKRKKLKDIHFFKGGKHDDKEKKSTIID
FT                   GKQPTTIYGFNEDMLNFQLSLADDDEQEEIQRDEMLYEYEVDMNTDDLPYLRATIFRCT
FT                   DSGVPEAVGYLKYICNVYDEKTMYLKKEMIKKCDDLVREYRLTRNLVVRAYIIQARGLN
FT                   PPSGATDITTYIWIKNSNDMTNIPGGLSHNIKDTGHTKKQGYKPEFNRCYQLLCSFPDE
FT                   SIVQVCIMNQGSLSDEIIGYTYIDMEDRYFNQKIRQLMIDDLMPIELRSLKLENSTISH
FT                   GSLRCWFEIFNEEFAQLNPIKVLCSNEPDDYQLRLVIWKVNNAAMDDNSTISLFVRCIY
FT                   TDEDREDIRDTDTHYNSKDGKGIFNWRFVYNIKIPTNATNIKIQIHNYALLSSNEPIGE
FT                   ATLDLSAHFYRARKKKGYYPIPRFWLSCKHPAHKNKVRGNVEIEGSILIKSEAELDPVG
FT                   NGRDEPNKDPYLPPVTENRTYVDWVMINEKFGAATASIMHGLKWTGVWIVVGVIVIGIF
FT                   FLIFLFK"
     atgtcaagca ttgcgaaaaa gacccaatac aatattaagg tcgatataca cgaagtaaaa        60
     gacttaagtt ttcgtgagag tgcgaatgag aaagaaatta taccaaatcc ttatattgaa       120
     gtgacagtaa ataatgagaa gaagagtact acaaaaaaga atcaagcagt aaatgttgta       180
     tataatacat catttaattt ttcacaagat ttaacagatt ataaatttga aaggactagt       240
     gtagatgtat gtgttttaca taaatatact attcagagtg ctttaatagg aaaatgttcc       300
     tttggtttaa attttgttta ttccaaagtt caacattggt tatataggat atgggtaaaa       360
     ttaagaaatc cagatttgcc attagatgat gttggttttt tattaatatc tgttggtgtt       420
     tatggtccag gagattccat acctattgtt aatgatagtg ttaaaacgga tattcatgaa       480
     gatgtattta gtaataaagg tttggatata catattacac attatgattt gtgtttgaat       540
     atatttagag gtcaagatat agaattaata ggtaatagta cactgttttc taatatactt       600
     gaaccatatg taaaagtatc acataatgga tttgaagaat gtactaaagt aataagaaat       660
     gatccgaatc cagtatggaa tttaagtatt catattccta catgtactcc ttgttatgat       720
     aaaaatattc ttgtcgaatt aataaatgga gaacataatg gtattgttat atatagtatt       780
     ctcttagatt tttttgaaat attaaaaaga gaattagcac caagatggtt taatatttat       840
     tataatccac aaaatcaaat catgccaaga tatagtgaat atatgcaaaa cggatcaatt       900
     cagataaatt taaatagtac tacgactaat aataataata ataatagcac tgctataaac       960
     cctttaggta attatctttt ttcaggagca gctgaaaaaa tatttaaaaa tgctacacaa      1020
     gctattaata ttaatgatat attaggtgta acgaaagtac aaaatatgtt tactgatgat      1080
     acattaaagg agttctattt atatggtggt cgtatttttc tgagtgcaaa tgcaaccaaa      1140
     acacattcac caggtcctat ttgtataaaa tcagcaaaag tagaggtaga tgcacctaac      1200
     aaagaataca ttttttgtgc tgacatatat gaaatcttat cggttcgaaa taataaaatg      1260
     ggaaattatg acgattatga cggtggctac accaccacca acaacaacaa caagaacaaa      1320
     aataataata atgaaaataa taataatgac aataatgaca atatttacaa tagtaacaat      1380
     atttataata gcgcaagtga aaaaagacga agtcgataca ataataatta tgatgcgagc      1440
     ggagaaagca tcatctgcgt ttgtgctctt ggaccacata aactaaaaac cattcctcta      1500
     ttaccgaatg aagttggttc ttatgtttta aacgaaaatg ttggtagaat agatgagttt      1560
     cgtatatttt taccacaaaa taataatgaa caaatatatg atatattttt atatatatac      1620
     ataaaatcga atttggccgt tacaaattgg attaataata gaaggagtat atataatagt      1680
     gtcttattaa acaatgaata cgaatccgga gatagaaata aaaaacaggg attacataaa      1740
     atgggttcta taaataatat atcagaagat ataatgcaag attcggattt cttaaataat      1800
     tataaattaa caagttatgt acgtattcca tataaatatc ttttattaaa tgaaaacaag      1860
     cctaaatggt tttctatgaa gaatattgaa acaaatgttc atgaatataa tatatctttt      1920
     tttgctaatt taatacctta ccatgcttat aaaaagagac ccaaaagatt agaatataaa      1980
     ttatctagat atttttttcg tgctttaata tatgaaggat tacattttcc agcaaaagga      2040
     tataatgctt ttccagatcc ttatattaaa attgaattag ctggacaagt aattaaaaca      2100
     agtactatat tacatacatt gaatccgaat tattatgaag catatgaagt acaagttata      2160
     ttacctacta atttaaattt agctcctgat atatctatag aagctttatc tgtaaataaa      2220
     tcttttttat ataatgatga tatattattg ggatcatgta catttcctat tatgaaagta      2280
     ccaactgaat ggaagaaatc accaatatgg atacccttaa aatcatcaca atataaaaaa      2340
     tgtaaagcta aacttcttgt tgcttttgaa ttagtacctg ttgaaaaagt tctagatgat      2400
     acatatccat tctatgatga tataagacct tctacattac ctggtcacgt ctctttattt      2460
     ttaataggta tacgaatgtt taaaccttta aaagatcctt ccgtaacggt ttgttttggt      2520
     agagatgtcg atgatacatc tcaatttttg tggcatgaaa ctactaataa agtaatatca      2580
     ggaaaagaag gtaattggaa cttcttaaaa tatttttctt tagatgttat gttacctaaa      2640
     agaatgcaac accatagttt tctagaagtt agaatagaag ataggatatt aaatagtggg      2700
     ttcacaggaa ctgcatctag taatatgcat gctgtaaatg caacaaataa taatctttta      2760
     atagggactg catatataac tctaaatcca ttacttccat ggctagataa ttatgaaaaa      2820
     aatgaatgtg tagaattatt taaattacat ttactagaag aagttttaat agaagatgca      2880
     gaaatggata gaaaatctta caacagtgca ttgatatata aaaaaagttc aataatgtca      2940
     aggaaattgt ctaatgataa ttttgaaacg caacagatgg gagaagaaaa tggtatattt      3000
     aatgatatac ccatgaatac tttggaagaa aatgtgacca ttaaagggga tgatagcagc      3060
     gatgatgaaa aggataatag ttatgatgat gaaaaggata atagttatga tgatgaaaag      3120
     gataatagtt atgatgatga aaaggataat agttatgatg gtgatgataa aagtggtcat      3180
     tattatcata catgggaaga taataataac aataataata ataatgtaac tagtgatcat      3240
     acttgtaagc ataaaaatga acataataat aataaaaaag aggacgaaaa aagaaaaagg      3300
     gaaaaaaaaa atacatatac aacaaaccat gataaaagag aaaataataa cacacatatt      3360
     aataacaatt ataaacatgt tatagatata aaaaagaaga aaagaaaaaa gaatataaag      3420
     aaatatataa ataatgaata cgttccatac aatgatcccg atttttctaa tgtacgtata      3480
     gaagagacat tagaacatgt atgttttaaa ataaatgatt taacaaaaaa agagaataca      3540
     tatatttatt ataatgatga acaagaaact ttatgtgata gtatttcaag tgagaaaaga      3600
     aaaaaattaa aagatattca tttttttaaa ggtggtaaac atgatgataa agaaaagaaa      3660
     agtaccatta tagatggaaa gcaacctaca acgatatatg ggtttaatga agatatgtta      3720
     aattttcaat tatcattagc cgacgatgat gaacaagaag aaattcaaag agatgaaatg      3780
     ttatatgaat atgaggtaga tatgaataca gatgatttac catatttaag agcaacaatt      3840
     tttagatgta cagattcagg agttcctgaa gcggttggat atttgaaata tatatgtaat      3900
     gtgtatgatg aaaagacaat gtatttaaaa aaagaaatga taaagaaatg tgatgattta      3960
     gtaagagaat atagattaac acgtaattta gtagtacgtg catatattat acaagcaaga      4020
     ggtttgaatc caccctcagg tgcaactgat ataacaacat atatatggat aaagaatagt      4080
     aatgatatga caaatattcc aggaggatta tctcataata taaaagatac aggtcataca      4140
     aagaagcaag gatataaacc agaatttaat agatgttatc aattattatg ttcatttcct      4200
     gatgaatcga tagtacaagt atgtataatg aatcagggtt ctttatcaga tgaaattata      4260
     ggatatacat atatagatat ggaggataga tattttaatc aaaaaattag acaattaatg      4320
     attgatgacc ttatgccaat agaattaaga tctttaaaat tagaaaatag tacaatatct      4380
     catggatctt taagatgttg gtttgaaatt tttaatgaag aatttgctca actgaatcct      4440
     ataaaagtgt tatgttccaa tgaacctgat gattatcaat taaggcttgt aatatggaaa      4500
     gtaaataatg ctgctatgga tgataattcg acaataagtt tatttgttag atgtatttat      4560
     accgatgaag atcgtgaaga tataagagat acagatacac attataatag taaagatgga      4620
     aaaggaatat ttaattggag atttgtttat aatattaaaa taccaactaa tgcaacaaat      4680
     attaaaattc aaattcataa ttatgcttta ttatcatcta atgagcctat aggtgaggca      4740
     accttagatc tgtctgctca tttttatagg gcacgtaaga aaaagggtta ttaccccata      4800
     cccagatttt ggctatcgtg taaacaccca gctcacaaaa acaaagtaag aggaaatgta      4860
     gaaatagaag ggtccattct aataaaatct gaggctgaac ttgacccagt tggtaatgga      4920
     agggatgaac ctaataaaga tccttattta cctccagtta ctgaaaatag aacatatgtg      4980
     gattgggtga tgataaatga aaaatttggt gctgcaacgg cttcgattat gcatggctta      5040
     aaatggacag gtgtatggat tgtagtgggt gttatcgtaa ttgggatatt tttcctcata      5100
     tttttgttta aatga                                                       5115
//

If you have problems or comments...

PBIL Back to PBIL home page