(data stored in ACNUC9543 zone)

EMBL: AL844507.PE60

AL844507.PE60        Location/Qualifiers
FT   CDS_pept        344288..344821
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806400"
FT                   /product="UDP-N-acetylglucosamine transferase subunit
FT                   ALG13, putative"
FT                   /EC_number="2.4.1.141"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.133:mRNA"
FT                   /db_xref="GOA:Q8IAQ4"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR039042"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAQ4"
FT                   /protein_id="CAD51307.1"
FT                   /translation="MSSDMHLFVTVGSTNFDELIKYIDDEQFHFFLRNLGFSYMTIQIG
FT                   NGTYIPKLIYTNDNNINNNKLLKEVKYFTYKTNLDKYFEKAHFILSHSGAGTTLECLRK
FT                   KKKILIVVNHKLMSNHQSEFANYMHSCNYLDICNNLQNLKQNIHLSLKKDTYNAFPQAD
FT                   AQPFLKDLYNLIYN"
     atgagtagtg atatgcatct atttgttact gttggatcaa ctaattttga tgagctaata        60
     aaatatattg atgatgaaca gtttcatttt tttttaagaa atctagggtt ttcatatatg       120
     actatacaaa ttggtaatgg tacatatata cctaagctca tatatacaaa tgataataat       180
     ataaataata ataaattatt aaaagaagta aaatatttta cttataaaac gaatttagat       240
     aaatattttg agaaggcaca ttttatatta agtcattcgg gagcaggtac tacattagaa       300
     tgtttaagaa aaaaaaaaaa aattctcatt gttgttaatc ataaattaat gagtaatcat       360
     caatcagaat ttgccaatta tatgcattca tgtaattatt tagatatttg taataatcta       420
     caaaatttaa aacaaaatat acatctatct ttaaaaaagg acacatataa tgctttccct       480
     caagcagatg cccaaccatt tttaaaggat ctatacaatt taatatataa ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page