(data stored in ACNUC9543 zone)

EMBL: AL844507.PE61

AL844507.PE61        Location/Qualifiers
FT   CDS_pept        complement(345427..347454)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806500"
FT                   /product="DnaJ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0115:mRNA"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAQ5"
FT                   /protein_id="CAD51306.1"
FT                   /translation="MSNWNFFNDYLNWFNGTTESTTFHNRSSKKGSNKSVSTNSTSINT
FT                   NKNNINELSNSQPNNSGQTCDEMKASNDGFEKDVSKIKCAKKYNPFINIKEKYYKEYNN
FT                   MNTKKENNKSEKKCGIQIEGQNGNPSENPSENPSESQNENPIPCQIKKCDKENDQNIPK
FT                   SGNKNKDTNFFNQLGLSNWLPNYDMPIYNEYKKGYYLDKEAKEVLSKKGSKKSNVIKIG
FT                   GDSSNSNMNDFNVSDCGNNTCVDTTYYDALNIKPTAKLSEIKTSYYKLALKYHPDKNAN
FT                   DPEAKLKFQKINEAYQVLSDDERRRQYNKYGLNATKDMILIDPSIFFMMLFSSEELSDY
FT                   TGTLRIAFFVQLAFEGNMSIEDKKSSNQVMINEMEVEQKIREVELALLLRKRLQPYVDG
FT                   DVEWEEQMETEIKGLLESSFSSSILESIGWTYENVATSYIAEVTTLWGVGATVANIQAA
FT                   GRTIGNTFSAAKSMFNTVVTIKDFSLNSEKINSIKEKKDNLKTSSNNSLNNHSSSNKGS
FT                   SEQNGTNENLKCDNNQVNHKNNVNTSDNINNVNTSNTHENKEEEKKNTIIDKEENKALG
FT                   VIIKNVLTLVLWDIESTVRQATEKVIRDEDVNIETRLKRAEGMKFLGKLMQKWSKIKND
FT                   KCDTNDIDATKLLEKAIIKASKMPNDEDQGDQDNIKREYL"
     atgtcaaatt ggaatttttt taatgattac ctaaattggt ttaatgggac caccgaatct        60
     acaacatttc ataatagaag tagtaaaaag ggttctaaca aaagtgtatc aacaaattct       120
     acttctataa acactaataa aaataatatt aatgagctta gtaacagtca acctaataat       180
     agtggacaaa cttgtgatga aatgaaggcc tctaatgatg gctttgaaaa agatgtaagt       240
     aaaataaagt gtgccaagaa atacaatcca tttattaata taaaagaaaa atattataaa       300
     gaatataata atatgaatac taaaaaggag aataataaaa gtgaaaaaaa atgtggaatt       360
     caaattgaag gtcaaaatgg aaatccaagt gaaaatccaa gtgaaaatcc aagtgaaagt       420
     caaaatgaaa atccaattcc atgtcaaatt aaaaaatgtg ataaagagaa tgatcagaat       480
     atacccaaaa gtggtaataa aaataaagat acaaattttt ttaaccaact agggttatca       540
     aactggttac ctaattatga tatgccaatt tataacgaat ataaaaaagg ttattattta       600
     gataaagaag caaaagaggt tttatccaaa aagggttcta aaaaaagtaa tgttataaaa       660
     ataggaggtg atagtagtaa tagtaatatg aacgatttta acgtatccga ttgtggtaat       720
     aatacatgtg ttgatacaac atattacgat gcattaaata taaaaccgac agcaaaatta       780
     agtgaaataa aaacaagtta ttataagtta gcattaaaat atcacccaga taaaaatgcg       840
     aatgatccag aagcaaaatt aaaatttcaa aaaataaatg aagcttatca agttttgagt       900
     gatgatgaaa gaagaagaca atataataaa tatggattaa atgcaacaaa ggacatgata       960
     ttaattgatc catccatatt ctttatgatg ttatttagtt cggaagaatt aagtgattat      1020
     actggtacct tgagaatagc tttttttgtt cagctagctt ttgaaggtaa tatgtccatc      1080
     gaagataaaa aatcatctaa tcaggttatg ataaatgaga tggaagtaga acaaaaaata      1140
     agagaagtgg aattggcttt actattaaga aaaagattac aaccatatgt agatggagat      1200
     gtggaatggg aggaacaaat ggaaaccgaa ataaaaggat tacttgaatc ttcattttcg      1260
     agttctatat tagaatctat aggatggaca tatgaaaatg tcgcaacatc ttatatagct      1320
     gaagtaacta ccttatgggg tgtcggagca acggtagcta atattcaggc tgctggaagg      1380
     accattggaa ataccttcag tgcagctaag tctatgttta atactgtagt gactataaaa      1440
     gatttttcgt tgaatagtga aaaaattaat tctataaaag aaaagaaaga taatttaaaa      1500
     acatcatcga ataattctct gaataatcat tcttcttcca ataaaggatc cagtgaacaa      1560
     aatggaacaa atgaaaattt aaagtgtgat aataatcaag tgaaccataa gaataatgta      1620
     aacacttcag acaatataaa taatgtgaat acatctaata cacacgaaaa taaggaagaa      1680
     gaaaaaaaaa acacaattat tgataaagaa gaaaataaag ctctaggagt tattataaaa      1740
     aatgttctca ccttagtttt atgggatatc gaatcgacag taagacaagc caccgagaaa      1800
     gttataagag atgaagatgt gaacattgaa acacgattaa aacgtgctga aggaatgaaa      1860
     tttttaggaa aattaatgca aaaatggtca aaaatcaaaa acgataaatg tgatacaaac      1920
     gatatcgatg ctaccaaact tttagaaaaa gctattatca aagcttctaa aatgccaaac      1980
     gacgaagatc aaggagacca agataacatc aaaagagaat acctatag                   2028
//

If you have problems or comments...

PBIL Back to PBIL home page