(data stored in ACNUC9543 zone)

EMBL: AL844507.PE62

AL844507.PE62        Location/Qualifiers
FT   CDS_pept        complement(join(349317..351083,351400..351525,
FT                   351690..351924,352082..352733,353311..353362))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806600"
FT                   /product="kinesin-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806600"
FT                   /db_xref="GOA:C0H4S3"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S3"
FT                   /protein_id="CAX64099.1"
FT                   /translation="MYKRAYSESVVLSKNLYNKDSVKDTHHKLKTNEIIEKTETKLENV
FT                   VVRIRKLDKNEKSTLHTDPNDRTALYFDKDFEIEKYNFDIVFDENDDNQTIFNKIGGQF
FT                   IINNVCNGFKETIITYGQTGSGKTYTLFGSNKEYGIIYYFVHYLYKLCNSKNKNKKKAI
FT                   YLSIYEILGDTLIDLISNLNEKNIEFYTEEYYLKTIRYSYKVVNIQNYDIAKKIIDSAC
FT                   LLRNVEATSQNMRSSRSHAIIQFFVNISDCTLHNGIETIKDYYGVLTLVDLVGCEREEF
FT                   NTNKNEHRNDKTSSKFLNSSLTSLNKMLRKMQMGNLDESDKRQSVLCKVLFNYIQKTCG
FT                   VCLIFCFNPKISQKSLTSSTLIMASDCKKIKSKRKQLIYVKSENKESFFKKIANDDSSK
FT                   NGNNKEKEKKYEGSKWENYNTIKKNVENGKDKEEEMEKKHVENINNLVEIEENKYLRLE
FT                   NNCAIFLIYLNDDKQEDVINILNKKKDNGKLNSLKKILCDIINEQVKEEKKRKNVLEQL
FT                   KSDNLKLKNENDYWKKEAYNYHNKLKILNKNYLKMNEFLLKTLNASTNDNNTSSDYTTS
FT                   LFSKLDEKKGINDERQKNQTRGKNDMNLSSHNNDDTINNDNDDNNDDNNDDNNIDNNDN
FT                   NIDNIHNNIDNIHNNNNYYYNNQVVNTYAQLKQKKQLVQNKSAHILNNSSSDILRTSDK
FT                   GNSHNPTTYYNEDHLLLHKNNTQFIEEKNKQRKEYYKEVINNKGSNINKADDQTNNRIE
FT                   DNLRNHILNNINNEKNYINDYTNNKSYQEEIPYPNKEDNKHRSNKMMLQNNMIKGEIYR
FT                   KNIYEKYKENGVTNNMEIEMKNKKKINNLNSQNIQRNNSMKETTNMLSIDNINKKYYEQ
FT                   YKNISPENNTCIITDKLNLLQKKKDTTKNIIHPLSNNDNKMLTNITIDSLATKIKNRLL
FT                   KSRSLSIAREHKI"
     atgtataaga gagcttatag cgaatcagta gttctatcaa agaatttata taacaaagac        60
     agtgttaaag atacacacca taaactaaaa acaaatgaaa ttatagaaaa gacagaaaca       120
     aaactagaaa atgttgtggt aagaattaga aagttagata aaaatgaaaa gtccacatta       180
     catacagatc caaatgatag aacagcatta tattttgata aagactttga aatagaaaaa       240
     tataatttcg atatagtttt tgatgaaaat gatgataatc aaacaatatt taataaaata       300
     ggaggacagt ttattattaa taatgtatgt aatggattta aagagaccat aattacttat       360
     ggacaaactg gaagtggtaa aacgtataca ttgtttggat ctaataaaga atatggaatc       420
     atttattatt ttgttcatta tttatacaaa ttatgtaatt caaaaaataa aaataaaaaa       480
     aaagctattt atttaagtat ttatgaaatt ttgggagata cacttattga tcttatatcc       540
     aacctcaatg aaaaaaatat agaattctat acggaagaat actatcttaa aactataaga       600
     tattcttata aagttgttaa tattcaaaat tatgatatag caaaaaaaat cattgacagt       660
     gcatgtcttt taagaaacgt tgaggcaaca tctcaaaata tgcgatcaag taggtctcat       720
     gcaataatcc aatttttcgt gaacatctcc gattgcacct tgcacaacgg catcgaaact       780
     ataaaagatt attacggtgt tttaacctta gttgacctgg ttggatgtga aagagaggaa       840
     tttaatacaa ataaaaatga acacagaaat gataaaacat ctagcaaatt tttaaattcc       900
     tcccttacgt cgctaaacaa aatgttgagg aaaatgcaga tgggaaatct tgatgagtca       960
     gataaaagac aaagcgttct ttgcaaagtt ctttttaatt atatccagaa aacttgtgga      1020
     gtttgcttaa tattttgttt taatccaaaa atcagccaaa aaagtctaac tagttccact      1080
     ttaattatgg ctagcgattg caaaaaaata aaaagcaaaa gaaaacaact gatttatgta      1140
     aaatctgaaa acaaggagag ttttttcaaa aaaatagcta acgatgattc atcaaagaat      1200
     ggtaataata aagaaaaaga aaaaaaatat gaaggatcaa agtgggaaaa ttacaatacg      1260
     ataaagaaga atgtagaaaa tgggaaagac aaagaagaag aaatggaaaa gaagcatgta      1320
     gaaaatataa ataacttggt agaaatagaa gaaaataagt atttaagact tgaaaacaat      1380
     tgtgcaatat ttcttatata tttaaatgat gataaacaag aagatgtaat aaacatttta      1440
     aataagaaaa aagataacgg gaaattaaat tctttaaaga aaatattatg tgatattata      1500
     aatgaacaag taaaagaaga aaaaaaacga aaaaatgtgt tagaacaatt aaaaagtgat      1560
     aatttgaaat tgaaaaatga gaatgattat tggaagaaag aagcttataa ttatcataat      1620
     aaattaaaaa tattaaataa aaattattta aaaatgaatg agtttctttt aaaaacatta      1680
     aatgcgagta caaatgataa taatacttca tcggattata ctacatcatt attttcgaag      1740
     ttggatgaga aaaaaggaat aaatgatgaa agacaaaaaa atcagacacg aggaaaaaat      1800
     gatatgaatt tgtctagcca taataatgat gatactatta ataatgataa tgatgataat      1860
     aatgatgata ataatgatga taataatatt gataataatg ataataatat tgataatatt      1920
     cataataata ttgataatat tcataataat aataattatt attataataa tcaggttgtt      1980
     aacacatatg cgcaactcaa acaaaagaaa caacttgttc aaaacaaatc agcacatatt      2040
     ttgaataata gttcaagtga tatattaaga acaagcgata aaggcaattc tcataacccg      2100
     acaacttatt ataatgagga tcatttatta ttacataaga ataatacaca atttattgaa      2160
     gagaaaaaca aacaaagaaa agaatattat aaagaagtaa taaataataa aggatcaaat      2220
     attaataaag cggatgatca aacgaataat cgcatagaag ataacttaag aaatcacata      2280
     cttaataata taaataatga gaagaattac ataaatgatt atacaaataa taaaagttat      2340
     caagaggaaa ttccttatcc caataaagaa gataacaaac atagaagtaa caaaatgatg      2400
     ttacaaaata atatgataaa aggagaaata tatagaaaaa atatatatga gaaatataaa      2460
     gaaaacggtg ttacaaataa tatggaaatt gaaatgaaaa ataaaaaaaa aataaataat      2520
     ttgaactctc aaaatataca aagaaataat tcaatgaaag aaactactaa tatgttgtcg      2580
     atagataata taaataaaaa atattatgaa caatataaaa acatttctcc tgagaacaat      2640
     acttgtataa taacagacaa attaaattta ttacaaaaaa aaaaagacac aacaaaaaat      2700
     attattcacc ctttatcgaa taatgataat aaaatgttaa ccaatattac tattgattct      2760
     ttagcaacaa aaataaaaaa tagattgttg aaatcaagaa gtttatcaat agctagagag      2820
     cataaaatat ga                                                          2832
//

If you have problems or comments...

PBIL Back to PBIL home page