(data stored in ACNUC9543 zone)

EMBL: AL844507.PE63

AL844507.PE63        Location/Qualifiers
FT   CDS_pept        join(354472..361893,362018..362083,362166..362396)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806700"
FT                   /product="conserved Plasmodium membrane protein, unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806700"
FT                   /db_xref="GOA:A0A143ZVL6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZVL6"
FT                   /protein_id="CZT62750.1"
FT                   /translation="MERDELKKGHKVVLCEENNDGMKKSDEYFSYIDENNINDYINDEN
FT                   GNHDDNKYIHSDDNKYIHSDDNKYIHSDDNNHVNNCSHFSYVKDMLECDEEKKDVGFMI
FT                   SDKERYEFLKYADYFFHEYKDNVHIYREIKFVLKTNNPSLLCLLKNICLLGHIIYFYED
FT                   LYEQKLLTSKDINNIENILYKNEDTVSNNYTIIYNCFLFLLEIIKLSIHTGVQKFAYYQ
FT                   MIRNKKLIQTISYNNFNYNPNKIKNKEHFFIKKDNEALFIKDMITLHIVNMLNQTHKHI
FT                   RLYALKLSILFISHISKSNHIINHIMNIIFQQINFEEYIHALVLFLKLVPYLSHDVLYH
FT                   IIKKLYKSLIKKKDECSNVHSLFMHIKKGGMENENPQKNIHHEKVSPYKVENHNVDGEK
FT                   GIQVGLQKEDDGNKEEKNEKHISDKNEEYISAQETKNPKEENISHMYNYLDIFKDLKCY
FT                   NNNNYYEDMYFSKKNKKNTYINKMIYIINDHFSFTKCLYFAMIGSKLNELYPYVSYYLF
FT                   KKLWNIINKIFYIPYNQCDENKIVHLLDVLFYNTTLLSFTNIFLLNLQIIILKFLLNIS
FT                   QTYIMKKRYITFYSIRALLYLIKKKKLFICMDYYIYQDKIMSNQAYPFNCMNHFLYMST
FT                   FQYSDILHILSVILFNNNNNNINDCNDNNINDCNDNNINDCNDNNINDCNDNNINYCND
FT                   NNINDCNDNNINDCNDNNINDCNDNNINYCNDNNINDCNDNNINYCNDNNINDCNDNNI
FT                   NDCNDNNINYCNDNNNNYYYYYNCNTLSIYFFIKLIYKFFKVIQRGTAPNIFNIHNNNI
FT                   YRKKIKNVLNIKKNKHKYNIMNHKVFKDTNKNMHKHSYTNFNFSYFDLNINKFLTLFKN
FT                   VQDECIQKKDSSKVKHIKKKKVDDIKDETLKEFIKNDNKDDINKKDLIINNNKNQPFYN
FT                   QNEHEETGKFNFLITIDDANNTTNKQKHADIFFHNFICTAKNKHTNNNINIKNLNITLD
FT                   IIRKKKTKRKKKKKKNKKKNKTNKIKKKYIYKIKYCNPYKNKNNSIIHKLISKMEKREQ
FT                   TKKKNKKKYHTNQKNIGKTKKNKSSKKIRNQHDEKKINQIINHNIDDHNGYQDIDDHNG
FT                   YQDIDDHNGYQGIDDHNGYQNVDDHNGYQDIDDHNGYQGIDDHNGYQNVDDHNGYQDID
FT                   DHNGYQDIDDHNGYQDIDDHNDYQDIDDHNNYQDTDDHNNYNNITSSYTTSSSSCIYSS
FT                   SSNLYNEQDYDEENEKEKEMESTNFIKDTQQNCIISNNNSYDNNSFNSDALHNEINTFS
FT                   HSSDINKNIMSNINVGSDEISEISFSKNSIFNEDTNNFLFINNDKQNKCTNKSTDKNTN
FT                   KSTNKSTNKNTNKSTNKIYNTHYISYAFHFLKQNKINLGNLIDEHKLYYHNYNENNLFT
FT                   HFKNEFFKKGKEKNSDIPNIIVLKQIMFIKILFFLYKHNNLLIIKLYILKTLSILSKHL
FT                   IFEEDIENFIRIFNYFVTHFLKQNDFTNTQTSTLLKHDNNNNVHTHSTELLKKQKYTNH
FT                   IFQNIYKQNEKETLYSNNSYNSDHTSYLGSVIMSSDSSTQEQKKNKTNKKNYLNNFVNY
FT                   LLNKNHMLILEETNSSFYNKNVLKNFIRIYITDIIHKLLKYKNQIILNSILYIFTSNQI
FT                   IPFFNLFHIFNKEGIEQILKEPFFYLTVEKKYINEKEKEREKANQDEHININHTNNNLF
FT                   EITKGDHKNEDKKSINKYPISYHHSYLNILNKHFFQSFQFDNISFNNVKALFYFSFFNF
FT                   INHKDSMIIFRKKTLTFLNILNDIYFFKTNKYVFYREKYREKLFCVDKTNDFACTSQAN
FT                   NLTHAGKMNELLCTSQVNKKLQYNERVGVLSYNERINLKIESMNGHKYINIEDDSIDKK
FT                   KKIDIKYDIKNNDIKNNDIKNNDIKNNDIKSDDIKSDDIKSDDIKSDDIKSDDIKSDDI
FT                   KSDDNKSDDIKSDDIKSNDVNNSENSNKFSDDDDYYSSSSCSVSISCVSYKSVDDGSTV
FT                   HYVSDDDKESVDDDFSISSISNKSFKHRIIKSYDNLYNEDMSTNENIQMTCDIHECSYI
FT                   YMYKIGLYCIISGYYNYGYKIFTKLYMMVNNRDIKLWLECLLNYCKFYYLKKNQQKQST
FT                   YLYVRKKSDKNNMYYIKNNRDEFYHNHNDFVNHCNYNIGYINPSKCLEKAQECIKQIIS
FT                   YKENFFHVFLFLQIKKNIYQAIENLIILINDIKYEINYTVKYFTYNIEEYINFLKSIFV
FT                   YILLLSNFKYEFSRLSKRILYIYMVLIKTLFVICIFMKNKIIPYLFLNSSFLLNTLMDD
FT                   NYTSGDQQNESTSEDDDDGNTNKSTCKYNNVYHKDHYNEYIYNQDGNIINLKKKNTKFN
FT                   LFIWGDDYTGYNFTRLYLERKKERIIRKKFFSKELKDVDGKSFQEIFEYIINLWKVSGQ
FT                   HFFFYDHIHNLNEMYYNLFKDNIINKKKILNFLKIYLLILNKINYPTPPRFLSSRAFPC
FT                   VVSRAYIYKSNFGKMEYEVESVKCIGHLENAQAHVIKQFYYCNIKLVLRNKIIRNINVK
FT                   AKGVSVLYTFHIQIENEDLKNFYIFMIPLDKDKQILGQAKPTDFFIKYV"
     atggaaagag atgaattaaa gaaaggacat aaagttgtac tgtgtgaaga gaataatgac        60
     ggaatgaaaa agagcgatga gtatttttcc tacatagatg agaacaatat aaatgactac       120
     ataaatgatg agaatgggaa ccatgatgat aataaatata tccatagtga tgataataaa       180
     tatatccata gtgatgataa taaatatatt catagtgatg ataataatca tgttaataat       240
     tgttcccatt ttagttatgt aaaagatatg ttagagtgtg atgaagaaaa aaaagatgtt       300
     ggttttatga taagcgataa agagagatat gaatttttaa aatatgcaga ttattttttt       360
     catgaatata aagataatgt acatatatat cgtgaaataa agtttgtatt aaaaacgaat       420
     aatccatctt tattatgttt attaaaaaat atatgtttat taggacatat aatatatttt       480
     tatgaagact tatatgaaca gaaattatta acatcaaaag atataaataa tatagaaaat       540
     atattatata aaaatgaaga tactgtttct aataattata ccattattta taattgtttc       600
     ctttttttat tagaaataat taaattaagt atacatacag gtgttcagaa atttgcttat       660
     tatcaaatga ttagaaataa aaaattgatt caaacaatat cttataataa ttttaattat       720
     aatccaaata aaataaaaaa caaagaacat ttttttataa aaaaagataa tgaagcatta       780
     tttataaaag atatgataac tttacatatt gttaatatgt taaatcaaac tcataaacat       840
     attcgtctat atgccttaaa attatctata ctatttatat cacatattag taaatctaat       900
     catataatta atcacattat gaatattatt tttcaacaaa ttaattttga ggaatatatt       960
     catgctttag tacttttcct aaaattagta ccatatctaa gccatgatgt tttatatcat      1020
     attatcaaaa agctgtataa atctttaata aaaaaaaaag atgaatgttc aaacgtacat      1080
     tccttattta tgcacataaa aaagggaggc atggaaaatg aaaaccctca aaaaaatatc      1140
     caccatgaaa aggtatcccc atataaggtg gagaatcaca atgttgatgg ggaaaaaggt      1200
     atacaggttg gtttacaaaa agaagatgat gggaataaag aagaaaaaaa tgaaaaacat      1260
     ataagcgata aaaatgaaga atatatatct gcacaagaaa caaagaatcc aaaggaggag      1320
     aatatatcac atatgtataa ctatttagat atatttaaag atttaaaatg ttataataat      1380
     aataattatt atgaagatat gtatttttca aaaaaaaata aaaagaatac atatataaac      1440
     aaaatgatat atataataaa tgatcatttt tcttttacaa aatgtttata ttttgcaatg      1500
     ataggaagta aattgaatga attatatcca tatgtttctt attatttatt taaaaaactt      1560
     tggaatatta taaataaaat tttttatata ccatataatc aatgtgacga aaataaaatt      1620
     gtacatttgt tggatgtcct tttttataat actacattat taagttttac aaatatattt      1680
     ttattaaatt tacaaattat tatattaaaa tttttattaa acatatcaca gacatatata      1740
     atgaagaaaa gatatataac cttttattca ataagggcct tattatattt aataaaaaaa      1800
     aaaaaattat ttatttgtat ggattattat atatatcaag acaaaattat gagtaatcaa      1860
     gcgtatcctt ttaattgtat gaaccatttt ttgtatatgt ctacctttca atattctgat      1920
     atattacata tattaagcgt tatattgttt aataataata ataataacat aaatgattgt      1980
     aatgataaca acataaatga ttgtaatgat aacaacataa atgattgtaa tgataacaac      2040
     ataaatgatt gtaatgataa caacataaat tattgtaatg ataacaacat aaatgattgt      2100
     aatgataaca acataaatga ttgtaatgat aacaacataa atgattgtaa tgataacaac      2160
     ataaattatt gtaatgataa caacataaat gattgtaatg ataacaacat aaattattgt      2220
     aatgataaca acataaatga ttgtaatgat aacaacataa atgattgtaa tgataacaac      2280
     ataaattatt gtaatgataa taataataat tattattatt attataattg taatacactt      2340
     tccatatatt tctttatcaa attaatttat aaatttttta aagttataca aaggggaacg      2400
     gcacctaata tttttaatat acataataat aatatataca gaaagaaaat aaaaaatgtt      2460
     ctcaacataa aaaaaaacaa acacaaatat aatataatga atcataaagt ttttaaagac      2520
     acaaacaaaa atatgcacaa gcattcttat acgaatttta atttttctta ctttgatttg      2580
     aacataaata aattcttaac attatttaaa aatgtacagg atgaatgtat tcaaaagaag      2640
     gacagctcca aagttaaaca tatcaaaaaa aaaaaagttg atgatataaa ggatgaaaca      2700
     ttaaaggaat tcataaaaaa tgataataag gatgatatta ataaaaaaga tcttattatt      2760
     aataataata aaaatcaacc attttataat caaaatgaac atgaagaaac agggaaattc      2820
     aactttctta taacaatcga tgatgctaat aatacaacaa acaaacaaaa acatgctgat      2880
     atttttttcc acaattttat ttgtacagca aaaaataaac acacaaacaa taatataaat      2940
     attaaaaatt taaacataac actcgatatt attaggaaaa aaaaaaccaa aaggaaaaag      3000
     aaaaagaaaa aaaataagaa aaaaaataag accaataaaa ttaaaaaaaa atatatatat      3060
     aaaataaaat attgcaatcc atacaaaaat aaaaataata gtattataca taaattaata      3120
     agtaaaatgg aaaaaagaga acaaacaaaa aaaaaaaata aaaaaaaata tcatacaaat      3180
     caaaagaata taggaaaaac aaaaaaaaat aaatcaagta aaaaaataag gaaccaacat      3240
     gatgaaaaaa aaatcaatca aattattaat cataatatag atgatcataa tggttatcaa      3300
     gatatagatg atcataatgg ttatcaagat atagatgatc ataatggtta tcaaggtata      3360
     gatgatcata atggttatca aaatgtagat gatcataatg gttatcaaga tatagatgat      3420
     cataatggtt atcaaggtat agatgatcat aatggttatc aaaatgtaga tgatcataat      3480
     ggttatcaag atatagatga tcataatggt tatcaagata tagatgatca taatggttat      3540
     caagatatag atgatcataa tgattatcaa gatatagatg atcataataa ttatcaagat      3600
     acagatgatc ataataatta taacaatata actagtagtt atactacttc ttctagtagt      3660
     tgtatttata gtagtagtag taatttatat aatgaacagg attatgatga agaaaatgaa      3720
     aaagaaaaag aaatggaatc aaccaatttt ataaaagata cacaacaaaa ttgtattatt      3780
     agtaataata atagttatga taataatagt tttaatagtg atgccttaca taatgaaatc      3840
     aatacatttt cgcattcttc agatataaat aaaaatataa tgtctaatat aaatgttgga      3900
     agtgatgaaa taagcgaaat tagcttttcc aaaaattcaa tttttaatga agatacaaat      3960
     aattttttgt tcataaataa tgataaacaa aataaatgca caaataaaag tacagacaaa      4020
     aatacaaata aaagtacaaa taaaagtaca aacaaaaata caaataaaag cacaaataaa      4080
     atatataaca cacattatat atcttatgct tttcattttt taaaacaaaa taaaataaac      4140
     ctaggcaacc taatagatga acataaatta tattatcata actataatga aaacaatcta      4200
     tttacacatt ttaaaaatga attctttaaa aaaggaaaag aaaaaaattc tgacatacca      4260
     aatatcattg tcttaaaaca aatcatgttt ataaaaatcc ttttctttct ttataaacat      4320
     aacaacttat taattatcaa actatatatt cttaaaacgt tatctatttt atcaaaacat      4380
     ttaatttttg aagaagatat agaaaacttt ataagaatat tcaattattt tgttacacat      4440
     tttttaaaac aaaatgattt tactaataca cagacatcaa cattattaaa acatgataac      4500
     aacaataatg tacatactca ttctactgaa ctattaaaga agcaaaaata tacaaatcat      4560
     atattccaaa atatatacaa acaaaatgaa aaggaaacat tatatagtaa taactcatat      4620
     aattcggatc atacatctta tttaggaagt gtaattatgt catcagattc ttctacacaa      4680
     gaacaaaaaa aaaataaaac aaataaaaaa aattatctta acaattttgt aaattattta      4740
     ttaaataaaa atcatatgct catattagaa gaaacaaata gctcatttta taataaaaat      4800
     gtattaaaaa attttatacg tatatatata acagatatta tacataaatt attgaaatat      4860
     aaaaaccaaa taatattgaa ttccatactt tatattttta caagtaatca aattatacca      4920
     ttctttaatt tgttccatat ttttaataaa gaaggtattg aacaaatatt gaaagaaccc      4980
     ttcttttatt taacagtaga aaaaaaatat ataaacgaaa aggaaaagga aagggaaaaa      5040
     gcaaaccaag atgaacatat aaatattaat cataccaata ataatctttt tgaaataaca      5100
     aaaggagacc ataaaaatga agacaaaaaa agtattaata aatatcccat ttcttatcat      5160
     cattcttatc ttaatatttt aaacaaacac ttttttcaat cattccaatt cgataatatt      5220
     agttttaata atgttaaagc acttttttat ttctcctttt ttaattttat taatcataaa      5280
     gattctatga ttatatttag aaaaaaaact ctcacattct taaatattct aaatgatata      5340
     tattttttta aaaccaacaa atacgtcttt tatcgtgaaa aatataggga aaaattattt      5400
     tgtgtagaca aaactaatga ttttgcatgt acaagtcagg caaataactt aacacatgca      5460
     ggaaaaatga acgaattatt atgtacaagt caggtaaata aaaagttgca atataatgaa      5520
     agagttggtg tattatcata taatgagcgg attaatttga agattgagag tatgaatgga      5580
     cataaatata ttaatattga ggatgatagt atagataaaa aaaagaagat agacataaaa      5640
     tatgatataa aaaataatga tataaaaaat aatgatataa aaaataatga tataaaaaat      5700
     aatgatatca aaagtgatga tatcaaaagt gatgatatca aaagtgatga tatcaaaagt      5760
     gatgatatca aaagtgatga tatcaaaagt gatgatatca aaagtgatga taacaaaagt      5820
     gatgatatca aaagtgatga tatcaaaagt aatgatgtga ataatagtga gaactcaaat      5880
     aaattttctg atgacgatga ttattactca agttcttcat gtagtgtgtc gatatcttgt      5940
     gtatcttaca aatctgttga tgatggtagt actgttcatt atgtatcaga tgatgataaa      6000
     gaatctgttg atgatgactt ttcaatttct tcgatatcga ataaatcttt taaacatagg      6060
     ataataaaat catatgacaa tttatataat gaagatatga gtacaaatga aaatatacaa      6120
     atgacttgtg atatacatga atgttcttat atatatatgt ataaaattgg tttgtattgt      6180
     ataatttcag ggtattataa ttatggatat aaaatattta caaaattata tatgatggtt      6240
     aataatagag atataaaatt atggttagaa tgtttattaa attattgtaa attttattat      6300
     ttaaaaaaaa accaacaaaa acaaagtaca tatttatatg taagaaaaaa aagtgataaa      6360
     aataatatgt attatataaa aaataataga gacgaatttt atcataatca taatgatttt      6420
     gttaatcact gtaattataa cattggttat atcaatccat caaaatgttt agaaaaggct      6480
     caagaatgta ttaaacaaat aataagttat aaagaaaatt tttttcatgt gttcttattt      6540
     ttacaaataa aaaaaaatat atatcaagct atagaaaatt taataatttt aataaatgat      6600
     ataaaatatg aaataaatta tactgtgaaa tattttacgt ataatattga agaatatata      6660
     aattttttaa aaagtatttt cgtatacata ttattactat cgaattttaa atatgaattt      6720
     tcacgcttat ctaaaagaat attatatata tatatggtat tgattaaaac attatttgtt      6780
     atatgtattt ttatgaagaa taaaattatc ccctacttat ttttgaattc ttcctttttg      6840
     ttaaatacgc tgatggatga taattataca agtggtgatc aacaaaatga aagtaccagc      6900
     gaagatgatg atgatggaaa tacaaataag agtacatgca aatataataa tgtatatcat      6960
     aaagatcact ataacgaata catttataac caggatggta atattataaa tttaaaaaaa      7020
     aagaatacaa aatttaactt attcatatgg ggagatgatt atacaggata taattttacc      7080
     agattatatt tggaaagaaa aaaagaaagg ataatacgaa agaaattttt ttcaaaagaa      7140
     ttgaaagatg ttgatggaaa atcgtttcaa gaaatttttg aatatataat aaatttgtgg      7200
     aaagtatcag gacaacattt tttcttttat gatcatatac acaacttaaa tgaaatgtat      7260
     tataatttat ttaaagataa tataataaat aaaaaaaaaa tcctcaattt tttaaaaatc      7320
     tatcttttaa ttctaaacaa aattaattat ccgactcctc ctcgtttctt atcatctcgt      7380
     gctttcccat gtgtagttag tcgggcatac atatacaaat cgaactttgg aaaaatggag      7440
     tatgaagtgg agtccgttaa atgcataggt cacttggaaa atgcccaagc acatgtaata      7500
     aaacagtttt actattgtaa tattaaatta gttttgagaa ataaaattat aagaaatata      7560
     aatgtaaaag ctaaaggagt ttctgtatta tatacgttcc atatacaaat agaaaacgaa      7620
     gatttaaaga acttttatat cttcatgata ccactggata aagataaaca aatattgggc      7680
     caagccaagc caactgattt ttttattaaa tatgtataa                             7719
//

If you have problems or comments...

PBIL Back to PBIL home page