(data stored in ACNUC9543 zone)

EMBL: AL844507.PE64

AL844507.PE64        Location/Qualifiers
FT   CDS_pept        complement(363260..366421)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806800"
FT                   /product="V-type proton ATPase subunit a, putative"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0113:mRNA"
FT                   /db_xref="GOA:Q8IAQ8"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAQ8"
FT                   /protein_id="CAD51303.1"
FT                   /translation="MGIFRSEIMKHGTLVLPSDRAREYLDCLGKEVDIQFIDMNEKTMK
FT                   RQYKKYIQRIDDMERILRFLEENINKLPNVKIKKSKIDNFLEHDNIYELDQVEESLNRL
FT                   HVQFVRFCNNNKDLIDEKNNAIEEKHVILTALNQLSPGFIRGVGGLRGSVIGGDQQQQH
FT                   HHNNNNNNNIVSPFDEGIEENNISLSTHIMKDGINMMFTNISGVIKTKDQESFSRTIFR
FT                   AFRGNTYTYFQNIDEDADDNDLLKNVEELESLKSAGDTNNMYKNNKQHDTFSDKLDGKD
FT                   KNDKKKKKDLKSVFVVYCQGSAQSNIYDKIMKICKAYDVKTYDWPRTYEHAKKRLKELR
FT                   EIINDKEKALKAYEEYFINEIFVLINVVEPNKNSLIEEWKLFCKKERHIYNNLNYFEGS
FT                   DITLRCDCWYSANDEEKIRHILINKSSNDLVSALLLSDKILRPNVSPPTYIKTNEFTKS
FT                   YQSMVDTYGVPRYGEINPAISTIITFPFLFGIMYGDVGHGLCIFLFALFLIIMNNKVKN
FT                   KKNNNEMVTMLFDGRYMLLLMGFFAVYAGFLYNDFFSMPLNLFSSMFMLDKQVDNMEYY
FT                   KRREITDSATGEVQYAYPYIFGFDCKWLGAENELTYINSFKMKFSIIIGFIHMTFGVLM
FT                   KGFNALHFKRKMDFFFEFLPQLVMMLSMIGYLVFLIIYKWVTPVGYGGFQKQGIINTII
FT                   NMYLMKEINSTNQFYPYQSIIQILLLSLFVLCIPFMFICKPAIRTYHIMKEKQKINDHN
FT                   VHKKNRRGKKAMAKRNNNNNNNNNNQNDNKNMLLTNQNFNEAGAKEMINAFHHNAKTGG
FT                   ILLSTNSKKKIVTSDGNHNNNLLSMHKRNTMNNKISSSPYHNEQPDDVYDQYDEYDDDD
FT                   DDDNYDENEYLNKKKKKRTDDDIEAHLLSSTYEEKGLQSSSAAMRGGGAGEENHHEENI
FT                   SEIWIEQLIETIEFILGLISNTASYLRLWALSLAHQQLSFVFFEQTILNSLKRNSFMSV
FT                   LINLILFSQLFSILTIAVILCMDTLECFLHSLRLQWVEFQNKFYKGDGIPFKPFNIKKL
FT                   LNENE"
     atgggtatat ttcgatcgga gattatgaaa cacgggacat tagtgctgcc ttctgatagg        60
     gcaagggaat atttggattg cttaggaaaa gaagtggata tacaattcat agatatgaat       120
     gagaaaacaa tgaaaagaca atacaaaaaa tatattcagc gtattgatga tatggaaagg       180
     atattacgtt ttttagaaga gaatattaat aaattaccaa atgtaaaaat aaaaaagagt       240
     aaaatagata attttttaga acatgataat atatatgaac ttgatcaagt ggaagaatct       300
     ttaaatcgat tgcatgttca attcgtacgt ttttgtaata ataataaaga tcttatagat       360
     gaaaaaaata atgctataga agagaaacat gttatattaa cagccctaaa tcaactaagt       420
     ccgggattta ttagaggagt tggtggtttg agaggttctg taataggtgg ggatcaacaa       480
     caacaacatc atcataacaa taataataat aataatattg taagtccttt tgatgaaggg       540
     attgaagaaa ataatatatc tttatcaaca cacattatga aagatggtat taatatgatg       600
     ttcacaaata tatcaggtgt tataaaaacg aaagaccaag aaagttttag ccgtaccata       660
     tttagagctt ttagaggtaa cacatataca tatttccaaa acatagatga agatgcagat       720
     gataacgatt tattaaaaaa tgtagaagaa ttagaatcat taaaatctgc tggtgatact       780
     aataatatgt ataagaataa taaacaacat gatacttttt cagataaact agatggtaaa       840
     gataaaaatg ataaaaagaa aaaaaaagat ttgaaaagtg tttttgtggt atattgccaa       900
     ggttcagcac agagtaatat ttatgataag ataatgaaaa tttgtaaagc atatgatgta       960
     aaaacatatg attggccaag aacatatgaa catgcaaaaa agagattaaa ggaattaaga      1020
     gaaataatta atgataagga gaaggcttta aaagcatatg aagaatattt tataaatgaa      1080
     atatttgtat taataaatgt tgtagaacca aataaaaata gtttaataga agaatggaaa      1140
     ttattttgta aaaaagaaag acatatatat aacaatttaa attattttga agggagtgat      1200
     ataacattac gttgtgattg ttggtatagt gcaaatgatg aagaaaaaat tagacatata      1260
     ttaataaata agagttccaa tgatttagta tcagcattat tattatcaga taaaatatta      1320
     agacctaatg tatcaccacc aacatatatt aaaacgaatg aatttacaaa atcataccaa      1380
     tcgatggtag atacatatgg tgtacctaga tatggtgaaa ttaatcctgc tatatcaaca      1440
     attataacgt ttccattttt atttggtata atgtatggtg atgtgggaca tggattatgt      1500
     atttttttgt ttgctttatt tttaattatt atgaataata aagttaaaaa taaaaaaaat      1560
     aataatgaaa tggttactat gttatttgat ggtcgttata tgttattatt aatgggtttc      1620
     tttgcggtat atgctggatt tttgtataat gatttttttt cgatgccttt aaatttattt      1680
     tcttctatgt ttatgttaga taaacaagta gataatatgg aatattataa aagacgagag      1740
     ataacggatt cagcaacagg tgaagttcag tatgcatatc cttatatttt tggttttgat      1800
     tgtaaatggt taggagcaga aaatgaatta acatatatta attcttttaa gatgaaattc      1860
     tccataataa taggttttat acacatgacc tttggtgtgc ttatgaaagg atttaatgct      1920
     ttacatttta aaagaaaaat ggattttttt tttgaatttt taccacaatt ggttatgatg      1980
     ttatccatga tcggttattt agttttcttg attatttata aatgggttac tccggttgga      2040
     tatggaggtt ttcaaaaaca aggaatcatt aatactatta taaatatgta tttaatgaaa      2100
     gaaataaata gtacaaatca attttatcca tatcaaagta taatacaaat attgttatta      2160
     tccttgtttg ttttatgtat tccttttatg tttatatgta aacctgctat tcgaacatat      2220
     cacatcatga aagaaaaaca aaaaatcaat gatcataatg ttcataaaaa gaacaggaga      2280
     gggaaaaaag caatggccaa aagaaataat aataataata ataataataa taatcaaaat      2340
     gataataaga atatgctctt aacaaaccaa aattttaatg aagctggagc caaagaaatg      2400
     ataaatgcat ttcatcacaa tgcaaaaacg gggggtatcc tcttatcaac aaatagtaaa      2460
     aagaaaattg taacatcaga tggtaatcat aataataatt tgttatctat gcataaaaga      2520
     aatacgatga ataataaaat atcctcttca ccttaccaca atgaacaacc tgacgatgta      2580
     tatgatcaat atgacgaata cgatgatgat gatgatgatg ataattatga cgaaaatgaa      2640
     tatttaaata aaaaaaaaaa aaaaagaaca gatgatgata tagaagctca tttattaagt      2700
     tctacatatg aagagaaagg attacaaagt tcatcagcag ccatgagagg aggaggagca      2760
     ggagaagaga atcatcatga agaaaacatt tcagaaatat ggattgaaca attaatagaa      2820
     acaattgaat ttatattagg attaattagt aacacagcat catatttaag attatgggca      2880
     ttatcattag ctcatcaaca attatcattt gtcttttttg agcaaaccat tttaaattcc      2940
     ttaaagagaa atagttttat gtctgtatta attaacttaa tattattttc tcaattattt      3000
     tcaatactta ccatagctgt tatattatgt atggacacac tggaatgttt cttacattca      3060
     ttaagattgc agtgggttga atttcaaaat aaattttaca agggagatgg tattcccttc      3120
     aagcctttca acataaagaa gttgttgaac gaaaatgagt aa                         3162
//

If you have problems or comments...

PBIL Back to PBIL home page