(data stored in ACNUC9543 zone)

EMBL: AL844507.PE65

AL844507.PE65        Location/Qualifiers
FT   CDS_pept        complement(368607..369746)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0806900"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0806900"
FT                   /db_xref="GOA:A0A143ZWH7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZWH7"
FT                   /protein_id="CZT62751.1"
FT                   /translation="MRQGLCKRLVLLVSLNILIFIMVNYNFCSFGFIINRNEVMKGSSI
FT                   IIDNMKKKQSREKRKNIGFVNCFILRNNKIRWGKKEENNKKINIKRIFLFDRSVDKVSG
FT                   HFLQDRGLFIEADKKMKIIEEIEKMTKLEYKNVEKYLNVLSENDVYEEVINHKFYMYKK
FT                   NNEKEKHDRLIKIQEFLNPFIINLRKKKAKEKVEYLIACIIKGVNIDEVITEMFKRKMI
FT                   DIYVLTFIDDKIMEAHTKLLKDDKLNNKDEQMSISEKILRTLKDRIIAQQKLNKKGTFV
FT                   FTRLLFLSSTLDINEDRKSMIKSMINTIEQLEEFELYLLDALEYAHENDKLQKYIPHME
FT                   LLLNACKQVNPVYNQTLNKQSENIGFFPESVDPSNLKNF"
     atgaggcagg ggctatgtaa aaggctagta ttattggtgt ccttaaatat attaatattt        60
     ataatggtta actacaattt ttgtagtttt ggttttataa taaatagaaa tgaagtaatg       120
     aaaggtagca gtataataat agataatatg aagaagaagc agagcaggga aaaaagaaag       180
     aatattggat ttgtgaattg ttttatttta agaaataaca aaataagatg ggggaaaaag       240
     gaagaaaata ataagaaaat aaatattaaa agaatatttt tgtttgacag aagtgtcgat       300
     aaagtgagtg gtcatttttt acaagacaga ggattattta tagaagctga caagaagatg       360
     aaaattatag aagagataga aaagatgaca aaattagaat ataaaaatgt tgaaaaatat       420
     ttgaatgtat taagtgagaa tgatgtatat gaagaagtaa taaatcataa attttacatg       480
     tataaaaaaa ataatgaaaa agaaaaacat gataggttaa taaaaataca agaattttta       540
     aatcctttta taataaattt gaggaaaaaa aaagcaaaag aaaaagttga atatttaata       600
     gcttgtatca taaaaggtgt aaatatagat gaagtaataa cagaaatgtt taaaagaaaa       660
     atgattgata tttatgtatt aacatttata gatgacaaaa ttatggaagc acataccaaa       720
     ttattaaaag atgacaaatt aaataataaa gatgaacaaa tgagtatatc tgaaaaaata       780
     ttaagaacat taaaagatcg tattatagct cagcaaaaat taaataaaaa aggaaccttt       840
     gtatttacaa gattattatt cttatcatct accttagata ttaatgaaga tagaaaatca       900
     atgattaaat ctatgattaa tactattgaa caattagaag aatttgaatt atatttatta       960
     gacgctctag aatatgcaca tgaaaatgat aaattacaaa aatatatacc acatatggag      1020
     ctccttctaa atgcatgtaa gcaggtaaat cctgtatata accaaacctt aaataaacaa      1080
     agtgaaaata ttgggttctt tccagaaagt gttgatcctt ccaatttaaa aaatttttaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page