(data stored in ACNUC9543 zone)

EMBL: AL844507.PE66

AL844507.PE66        Location/Qualifiers
FT   CDS_pept        join(370784,370911..370987,371150..371282,371493..371611,
FT                   371735..371785,371920..372022,372137..372252,
FT                   372424..372454,372586..372623)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807000"
FT                   /product="YEATS domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.131:mRNA"
FT                   /db_xref="GOA:C0H4S5"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR038704"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S5"
FT                   /protein_id="CAX64101.2"
FT                   /translation="MENRMQNVKLIKPLVVGTYAFLLSPQEKKKYGNMTHKWTCLVRCP
FT                   ESTDISLIVSKVVFELDPSFMYPKRVYTQPPYEVNEIGWGEFYLQVKIHFVDLTLSPIS
FT                   IVHFVKLNTDSDPNNIPPCVVNETYEEIIFKNPTVHFYNKFLQCNNTKIAPHKFQEHFI
FT                   KYDFKEDSYTKKYLQFQSEVQQEICDLMSEATLLSKDINDVQQKYFTMKSEMGVSSDEN
FT                   "
     atggagaatc gaatgcaaaa cgttaagtta ataaaacctt tggtggttgg aacgtacgca        60
     tttttattat ctcctcagga aaaaaaaaaa tatggtaata tgacacataa atggacatgc       120
     ttagtaagat gtcctgaatc tacggacatt tctcttattg ttagtaaagt agtttttgaa       180
     ttagatcctt cctttatgta ccctaaaaga gtgtatacac aaccaccata tgaagtgaat       240
     gaaataggat ggggtgaatt ttatttacaa gttaaaatac attttgtaga tttaacatta       300
     tccccaataa gtattgtgca ctttgtcaag ctcaatactg attctgaccc caataacatc       360
     ccaccttgtg tagttaatga gacatatgaa gaaattattt ttaaaaatcc tactgttcat       420
     ttttataata aatttttaca gtgtaacaat acaaaaattg ctccgcacaa atttcaagag       480
     cactttataa aatatgattt taaagaagat agttatacaa aaaagtatct gcaatttcaa       540
     tcggaagtgc agcaagaaat ttgtgatttg atgtcagagg caacattatt atcaaaggac       600
     attaatgacg ttcaacaaaa atacttcaca atgaaatctg agatgggtgt gagtagtgat       660
     gaaaattaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page