(data stored in SCRATCH zone)

EMBL: AL844507.PE68

AL844507.PE68        Location/Qualifiers
FT   CDS_pept        join(378024..378447,378626..379446)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807200"
FT                   /product="conserved Plasmodium membrane protein, unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.130:mRNA"
FT                   /db_xref="GOA:C0H4S6"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S6"
FT                   /protein_id="CAX64102.1"
FT                   /translation="MKTMSMIHEVGLNKLSSLITQNIKQKIIKRKDSKEDNLKEVKVNN
FT                   TKEKLTDQKFKLICICFGYIINTFLYFLFVYISDLIFTHCIFTLSKITNKNYYDNSIVN
FT                   SIKHFSILFIWYNYLSGGFDGDPFFHFFKNKMKLINKVECAISFASNISGTILYLITFQ
FT                   LMNLPKYEEHKGINITNYIKDNNISKDNSFLTFLVYPYIPDYLKNVLSNILIFIMPYNT
FT                   LEKKYDNKIFFNNKDLYSSIIMDTFINEFICSFLSYILLYIYMFTKNNLSQPININLIL
FT                   TQIISLFSSTYKHIICGPYMSLSWIIHDAYLKKYPLYFSMMLMLSHFYAYKLATLLLKI
FT                   PTISLTEAKRYFHNIHYDSLNKYTNKNGDVNLHSVPDHLINNTPLQNTYLSKIAKLYLT
FT                   TFIFKIHKKKGLKSE"
     atgaagacca tgagcatgat tcatgaggtg ggtttaaata aactatcatc cttaattacc        60
     caaaatataa aacagaaaat aataaaaaga aaggatagca aagaagataa tttaaaagaa       120
     gtaaaagtaa ataatacaaa agaaaaatta acagatcaaa aatttaaatt aatatgtata       180
     tgtttcggat atattataaa tacattttta tactttcttt ttgtatatat atctgatttg       240
     atatttactc attgtatatt tactctatct aaaattacga ataagaatta ttatgataat       300
     tcaattgtta actctataaa acatttttct attcttttta tatggtacaa ttatctttcg       360
     ggtgggtttg atggcgaccc cttttttcat tttttcaaaa acaaaatgaa gttaataaat       420
     aaagtggagt gcgccatatc atttgcctca aacatctcgg ggaccatact atacctaata       480
     actttccaac ttatgaattt accaaaatat gaagaacaca aaggaattaa tattacgaat       540
     tatattaaag ataacaatat ttcaaaagac aattcatttt taacatttct tgtgtatcct       600
     tatattcccg attatttaaa aaatgtatta tcaaacattt tgatctttat aatgccatat       660
     aatactttag aaaaaaaata tgataataaa atatttttta ataataaaga tttatattca       720
     tctattataa tggatacatt tataaatgaa tttatatgtt catttttaag ttatatatta       780
     ttatatatat atatgtttac aaaaaataat ttatcacaac ccataaatat taatttaata       840
     ttaacacaaa taatatcctt attttcaagt acatataaac atattatatg tggaccatat       900
     atgagcttaa gttggatcat acatgatgct tatctaaaga agtatccttt atacttttct       960
     atgatgttaa tgctttcaca tttctatgct tataaactag caacccttct acttaaaata      1020
     cctacaatat ccttgacaga agccaaaaga tattttcata acattcatta tgattcttta      1080
     aacaaatata caaataaaaa tggagatgtt aacttgcact cggtccctga ccatcttata      1140
     aacaacactc ccttacaaaa tacatatctt tcaaaaattg ctaaattata tttgacaacc      1200
     tttatattta aaatacataa aaaaaaaggt ctcaaaagtg aatga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page