(data stored in SCRATCH zone)

EMBL: AL844507.PE7

AL844507.PE7         Location/Qualifiers
FT   CDS_pept        complement(join(65716..70434,70567..70832,70993..71785))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800700"
FT                   /product="surface-associated interspersed protein 8.3
FT                   (SURFIN 8.3)"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800700"
FT                   /db_xref="GOA:A0A143ZWG8"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZWG8"
FT                   /protein_id="CZT62741.1"
FT                   /translation="MAVEMNTPVSKKGVSSTAYSIYFSVFLKRLKSYVSDRISRIKNAT
FT                   DYEKPCRDLNYEIDEVKDLFCTRYLLNIPRYVRLASWNKNIEDHLKATMVSDSNQKCKR
FT                   SYPFYPRIQRYRRKLLADYCEERDKRRDVLNSSNDKDKCLEFNEWVIMSDNAINDSFNN
FT                   KITEGDRNKGAYTISNRCSLRKPHLLFPLLECHEEKKKEEEPEKKSDSDDEDLNKPKIP
FT                   EQDHKNVIPGIIGFSNSPSYVGFNPVHAESGMFRHSSPGLTFDKLNIFFDSPIFGHSKI
FT                   TGTAEGFGNIFNMHIEPKDVAIPFDTSPPVSIPASNVTVGSNTPVKITPYLMFTPAVLI
FT                   IVFISIILNLMNKKKPMIPVKIKEKIKVKSAVPSAEHIRIEELEKLREEMREKELEKLR
FT                   KKIHVPKKVEIIEEPYKIKLLERKKWLWKTIIEIHMLILEEQRKAEWEFNKADFLHICI
FT                   DEFSNQEKKSDINVIRSDLLFDEPEVIENIHMMNKQSDIWYRWVERNAHMLEKWKEEKW
FT                   FLRLKESWRDEEEEYMKRAYKELLISLRGDKYYMSQRQKIIWRKWIAKHTIRVREFVID
FT                   KWFNQLFEELEKEGIISDEAIRNFLSQHKEAYDEEKIEAFIKYKKKLLVVILWIKIYMS
FT                   VLEEYVKEEDIESEKLFIDTSLEELKKKKEIEEEVIEDLKKDIYEIDEKKEIEKYKGED
FT                   WFKQMQQDWIRRDYKFVSSYNLESDDEKEFHEFVKKPTMEIQKDLLKEQWKNIELKWIE
FT                   EDNYDAYLLEDKLLKKTEYIKPRDKMKHRIIKEDDIYSEQLKVFDEIEKRSIYLSSKRV
FT                   LKWKTIIEIHLEVLHDCKKEEWDNNKGDFLNICIEELVKGQNEDKKNKENYNYITNESD
FT                   NYDIVEYTKSFCNTWTDRHNYMLEKWNKENWFVQLKNDWKKEQNEYMRKTYKELLISLK
FT                   GDKYNMSQRQKIIWKKWIAKHPNKMNEEIINIWSNQLSDEIDKNGIISDEAIKNFLSLE
FT                   KDISDKDLLKCRKKKLEVILWVKIYMSVLEEQKNEELEKSKESFLNTCIDELKKEEYSE
FT                   ENERMITIVDEMKKGFRICDKVEDYKKKKKWKNEEWYKDLKKEWIKEEDKYKDAMDIME
FT                   KDEIYEDDLLNKSIVELEKSVSLKHWKDMYIKWIDEDNERDWLRIAIDKKNLKTDEINE
FT                   DINRMIELNMLEDYSNDLYDKKKIKWKTIIEIHMEVLNDCKNDEWEMNKGDFLDICLEE
FT                   FGTMENREYSHIINNMLMVGELEYKHLNMDVIERQNDLWNKWIEGHRYMLEKWKKEKWF
FT                   IVLKENWKNEEHKYMRKAYLELLMSLREDVKNPMLQRQKIIWRKWIAKNLYHIESNVMK
FT                   KWFDKLLEEILRKGAIEEDECINLIEMEENEEYLEELKEYRKKKLICIIWIKIYMMIIE
FT                   EHKKEEYLESKEIFLDTCVDELKEQEILEGNELYMDDMKKSILLSDQKEEIEKLKMKNW
FT                   YKDLKKEWMSEEDRYFRSIINEENDEEYKNMISRPLRDIEKKISKKHWDDIQLKWIDED
FT                   NERDWLKIARNENDEDNYAYEYVRNRRKKYMDVYSGYYKRNRRKSGDKISGNEISGNEI
FT                   SGNEISGNKISGKINKINTEKEILNYDIIKEDNNNNDYMNNYMYYNDMENTYEQGSDYR
FT                   RKDEYFDICFDLLKKGNMYYTNLWIENKKMDDSYEYLDKVLNKMLEKHKFLLYNVKERN
FT                   KELIDEWEREEWFINLWNDWNEERNNHMKSIMPYKYNITNFVEEEKKIWKEWISKIINS
FT                   VEEWEHEYWFNDLLERYEMYAIDFSDEIYSIELENYLKDKILKIALLMDIFMAILDTSF
FT                   YEESEENNEYFTKSEMEHMEYDKIYDLNDEEEKIKIRKWFEKCITETQNGEIAKKNKMR
FT                   KGSFQKELEEKGIMSENLEGETSVYNKQMIKQKMNILKESYSRNEGNKSTL"
     atggctgttg aaatgaatac cccagtatcc aaaaaggggg taagctctac tgcatattcc        60
     atatatttta gtgttttttt gaaaaggtta aaaagttatg tttccgatag aattagtcgt       120
     ataaaaaatg caactgatta tgaaaaacca tgtagggatt taaactatga aattgatgaa       180
     gtaaaagatt tgttttgtac acgttattta ttaaatattc caagatatgt tagattagca       240
     tcatggaata aaaatattga agatcattta aaagcaacaa tggttagtga ttcaaatcaa       300
     aaatgtaaaa gaagttatcc tttttatcca agaattcaaa gatatagaag aaaactgttg       360
     gcagattatt gtgaagaaag ggataaaaga agggatgtac taaattcaag taatgataaa       420
     gacaagtgtt tagaatttaa cgaatgggta attatgagtg acaatgcaat taatgattcg       480
     tttaataata agataacaga aggtgataga aataaaggag catatactat tagtaataga       540
     tgtagtttga gaaaaccaca ccttttattt ccactattag agtgtcatga ggaaaaaaaa       600
     aaagaggaag aacctgaaaa gaaaagtgac tctgatgatg aagatctaaa taaacctaaa       660
     attccggaac aagaccataa aaatgtaatt cctgggatta ttggattttc taattctccg       720
     tcatatgttg gttttaaccc tgttcatgcg gaatctggaa tgtttagaca tagttctcca       780
     ggtttaacct ttgataaatt gaatatattt tttgattcac ctatatttgg gcattcaaaa       840
     attacaggta ctgcagaagg ttttggaaat atttttaata tgcatattga acctaaagat       900
     gttgcaattc catttgatac ttccccccct gttagtatcc cagcttctaa cgttacagtt       960
     ggtagtaata ctcctgtgaa aataacacca tatcttatgt ttactcctgc agttttgata      1020
     atagtgttca tttccataat tctgaattta atgaataaaa aaaaaccaat gatacctgtg      1080
     aaaataaaag aaaaaattaa agtgaagagc gcggttcctt ctgctgaaca tataagaata      1140
     gaagaattag aaaagttacg tgaagaaatg agagaaaaag aattagaaaa attaagaaaa      1200
     aaaatacatg ttccaaaaaa agttgaaatt atagaggagc cttataaaat taaattgtta      1260
     gaaagaaaga aatggttatg gaaaactatt atagaaatac atatgttaat tttggaagaa      1320
     caaagaaaag cagaatggga atttaataaa gcagattttt tacatatatg tattgatgaa      1380
     ttttcaaatc aggaaaaaaa atcagatata aatgtaataa gaagtgattt gttatttgat      1440
     gaaccagaag ttatagaaaa tatacatatg atgaataagc aaagcgatat atggtataga      1500
     tgggttgaac gaaatgcaca tatgttagaa aaatggaaag aagaaaaatg gtttttaaga      1560
     ttaaaagaga gttggagaga tgaagaagaa gaatatatga aaagagctta taaagaatta      1620
     ttaattagtt taagaggtga taaatattat atgtctcaaa ggcaaaaaat tatttggaga      1680
     aaatggattg caaaacatac aattagagtc agagaatttg ttatagataa atggtttaat      1740
     caattatttg aagagctaga aaaggaagga atcatatctg atgaggccat aagaaatttt      1800
     ttatctcaac ataaagaagc atatgatgaa gaaaaaatcg aagcatttat aaaatataaa      1860
     aagaagttgt tggtggttat attatggata aaaatatata tgtcagtatt ggaggaatat      1920
     gtaaaggaag aagatataga aagtgaaaaa ttatttattg atacatcttt ggaagaatta      1980
     aaaaagaaaa aagaaataga agaagaagtg atagaagatt tgaaaaagga tatatatgaa      2040
     atagatgaaa agaaagaaat tgaaaagtat aaaggagaag attggtttaa gcaaatgcaa      2100
     caagattgga ttaggagaga ttataaattt gtttcgtcat ataatttaga aagtgacgat      2160
     gaaaaggagt ttcatgaatt tgttaaaaaa ccgacaatgg aaatacagaa agatttatta      2220
     aaagagcaat ggaaaaatat agaattgaaa tggattgagg aagataatta tgatgcatat      2280
     ttgttagaag ataaattgtt aaaaaaaacg gaatatataa aacctagaga taaaatgaaa      2340
     catagaataa ttaaagagga tgatatttat agtgaacaat taaaagtttt tgatgaaata      2400
     gaaaaaagga gcatttattt gtcgagtaaa agggtattga aatggaaaac catcattgaa      2460
     atacatttgg aggtattaca tgattgtaaa aaggaagagt gggataataa taaaggggac      2520
     tttttaaata tatgtataga agaattggta aagggacaaa atgaagataa aaaaaataag      2580
     gaaaattata attatataac aaatgaaagt gataattacg atatagtgga atataccaaa      2640
     tcattttgta atacgtggac agatagacac aattatatgt tagaaaaatg gaataaagaa      2700
     aattggtttg ttcaattgaa aaatgattgg aagaaagaac aaaatgaata catgagaaag      2760
     acatacaaag aattattaat tagtcttaag ggtgacaaat ataatatgtc tcagagacaa      2820
     aaaataattt ggaaaaaatg gattgcaaaa catcctaaca aaatgaatga agaaattata      2880
     aatatatggt caaatcagtt atcggatgag atagataaaa acggtattat tagtgacgaa      2940
     gctataaaaa attttttatc tttagaaaaa gatatatcgg ataaggattt acttaaatgt      3000
     aggaagaaaa aattagaagt aattttatgg gtaaaaatat atatgtctgt tttggaagaa      3060
     cagaaaaatg aagaattaga aaaaagtaag gagtcctttt taaatacatg tatagatgag      3120
     ttaaaaaagg aagaatattc tgaagaaaat gaaagaatga taacaatagt tgatgaaatg      3180
     aaaaagggat ttcgtatatg tgataaggtg gaagattaca aaaaaaaaaa aaaatggaaa      3240
     aatgaagaat ggtataagga tttaaagaaa gaatggataa aagaagaaga taaatataaa      3300
     gatgctatgg atataatgga aaaggatgaa atatatgaag atgatttgtt gaataaatcc      3360
     attgtggaat tagaaaaaag tgtatcatta aaacattgga aagatatgta tataaaatgg      3420
     attgatgaag ataacgagag agattggtta cgtattgcaa tagataaaaa aaatttaaaa      3480
     acagacgaaa taaatgaaga tataaataga atgatagaat taaatatgtt ggaagattat      3540
     tcaaatgatt tgtatgataa aaaaaaaata aaatggaaaa ctatcatcga aatacatatg      3600
     gaagttttga atgactgcaa aaatgatgaa tgggaaatga ataaaggaga ctttttagat      3660
     atatgcttgg aagaatttgg aactatggaa aatagggaat attcccatat tataaataac      3720
     atgttaatgg taggagaact agaatataaa catttaaata tggatgtaat agaaagacaa      3780
     aatgatttgt ggaacaaatg gatagaagga cacagatata tgttagaaaa atggaaaaag      3840
     gaaaaatggt ttattgtatt gaaagagaat tggaaaaatg aagagcataa atatatgaga      3900
     aaggcttatt tagaattgtt gatgagttta agagaggatg ttaaaaaccc aatgttacaa      3960
     aggcaaaaaa ttatatggag aaaatggatt gcaaaaaatt tatatcatat agaatcaaat      4020
     gttatgaaaa aatggtttga taaattatta gaagaaattc taagaaaagg agccattgaa      4080
     gaagatgaat gtataaattt aatagagatg gaagaaaatg aagaatattt ggaagaatta      4140
     aaagaatata gaaagaaaaa attaatatgt atcatatgga taaaaatata tatgatgata      4200
     attgaggaac acaaaaagga ggaatatttg gaaagtaaag aaatattttt ggatacatgt      4260
     gtggatgagt tgaaagagca agaaattttg gagggtaacg aattatatat ggatgatatg      4320
     aaaaaaagta tcctattaag tgatcaaaaa gaagaaatag aaaaattaaa aatgaaaaat      4380
     tggtataaag atttgaagaa agaatggatg agtgaggaag atagatattt cagatcaata      4440
     ataaatgaag aaaacgatga agaatataaa aacatgataa gcaggccatt aagagatatt      4500
     gagaaaaaaa tatcaaaaaa gcattgggat gatatacaat taaaatggat agatgaagat      4560
     aacgaaaggg attggttaaa aattgcaagg aatgaaaatg atgaagataa ttacgcttat      4620
     gagtatgtaa ggaataggag gaaaaaatac atggatgttt atagtggata ttataaaagg      4680
     aatagaagaa aaagtggaga taaaataagt ggaaatgaaa taagtggaaa tgaaataagt      4740
     ggaaatgaaa taagtggaaa taaaataagt ggaaagataa ataaaataaa tacagaaaag      4800
     gaaatattga attatgatat tattaaagag gataacaaca ataatgatta tatgaataat      4860
     tatatgtatt ataatgatat ggagaatact tatgaacaag gaagtgacta tagaagaaag      4920
     gatgaatatt ttgatatttg ctttgatttg ttgaaaaaag gaaatatgta ttatacaaat      4980
     ttatggatag aaaataaaaa aatggatgat tcatatgaat atttagataa ggtgttaaat      5040
     aaaatgttgg agaaacataa atttttgtta tataatgtga aagaaagaaa taaggaatta      5100
     attgatgaat gggaaagaga ggaatggttt attaatttgt ggaatgattg gaatgaagaa      5160
     agaaataatc atatgaaaag tataatgcca tataaataca atattacaaa ttttgttgaa      5220
     gaagaaaaaa aaatatggaa agaatggata tcaaaaatta taaatagtgt tgaggaatgg      5280
     gaacatgaat actggtttaa tgatttatta gaaagatatg aaatgtatgc aattgatttt      5340
     agtgatgaaa tatatagtat agaattagaa aattatttga aagataaaat attaaaaata      5400
     gcgttgctaa tggatatatt tatggcaata ttagatacaa gtttttatga agaaagtgag      5460
     gagaataatg aatattttac aaaatctgaa atggaacata tggagtatga taagatatat      5520
     gatttgaatg atgaagagga aaaaataaaa ataagaaaat ggtttgaaaa atgtataacc      5580
     gaaacacaaa atggagagat agcaaaaaag aataaaatgc gaaaaggatc atttcaaaaa      5640
     gaattagagg aaaaaggaat tatgagtgaa aacttagaag gtgaaacttc tgtatataat      5700
     aaacaaatga taaaacaaaa aatgaatata ttaaaagaaa gttatagtag aaatgagggc      5760
     aataaatcca cattatga                                                    5778
//

If you have problems or comments...

PBIL Back to PBIL home page