(data stored in ACNUC9543 zone)

EMBL: AL844507.PE70

AL844507.PE70        Location/Qualifiers
FT   CDS_pept        join(384298..384516,384954..385073,385254..385289,
FT                   385434..385499,385663..385797)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807400"
FT                   /product="coenzyme Q-binding protein COQ10 homolog,
FT                   mitochondrial"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.300:mRNA"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S7"
FT                   /protein_id="CAX64103.1"
FT                   /translation="MKINILKKGKKFYITNNHFNYDIKRNFTIFQNSFIKTNDIVYRKN
FT                   IDIVCAKDLFFYTILNVDRYKYFLPYVTDSKITEKNKEYFKANLQIENIFFKEKYDSLI
FT                   QFIYPTTITVSSEDTNIFHHLITEWIIKEKKNCINIDFYINFRLKNKIYQNFMNLYIKE
FT                   LGKKILYSFINESKSNSYKNTDVLHLIK"
     atgaagatta atatattgaa gaaaggcaaa aaattttata ttacaaacaa tcattttaat        60
     tatgatatta aacgaaattt tacaatattt caaaactcat ttataaaaac aaacgatata       120
     gtttatagaa aaaacattga tattgtttgt gcaaaagatt tattctttta tacaattcta       180
     aatgtagata gatataagta ttttctacca tatgtaacgg atagcaagat aacagaaaaa       240
     aacaaagaat attttaaagc caatttacaa attgagaata ttttctttaa agaaaaatat       300
     gactctttaa ttcaattcat ttacccaaca acaattacgg tatctagcga agatacaaat       360
     atttttcatc acttgataac cgagtggata attaaagaaa aaaagaattg cataaacatt       420
     gatttttata taaattttag gttgaaaaat aaaatatatc aaaattttat gaatttatac       480
     ataaaagagt tagggaaaaa aattttatat tcctttataa atgaatcaaa atcaaacagt       540
     tataaaaaca cggacgtttt acacttgata aaatag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page