(data stored in SCRATCH zone)

EMBL: AL844507.PE72

AL844507.PE72        Location/Qualifiers
FT   CDS_pept        complement(join(389596..389631,389766..393181,
FT                   393583..393831,393956..394259))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0807600"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0807600"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S8"
FT                   /protein_id="CAX64104.1"
FT                   /translation="MKNMNDENGSTIEGDPNTEKAKNKNNNNNDDINENIIDDEKKKKE
FT                   QQQDDEEDEEDDEDDDEEDDADNDLCDQNVLIIGDENLSFSNYIIEAYASSNIYIASTL
FT                   TEFQVNLLLKDLEKKKVNKCLHEKREIDDVSTNYGPFDFTRKFKERHVSKNVHIIFNVN
FT                   LFNLKSYFPKNFFKAVFLILPGLSFNINDIQLKYNDKVTTLRIYYFLILVTLEITYISM
FT                   KNSNIHLFWTSEKLKNFVENEEEEENNKNEPDDTNDLTQNDISLNDNEIYSHGNDGFKK
FT                   ESIHDTINSLKNLMFNNVEHDHDDNMDSNADHNMDSNADHNMDSNADHNMDSNADHNMD
FT                   SNEDHNMDSNTDHNIDSNTDHNMDSNADHNMDSNTDHNMDNVDGTINYEEDNNLNGQDE
FT                   YYEENEEGDYTNEKDVNLINSSDINLEDNNEDISNHDKEKDNNNKKDDDDNKKDDDNKI
FT                   DDDNKIDDDDNKIDDDNKIDDDDNKIDDDDNKIDDDDNKIDDDDNKKDDDDNKKDDDNK
FT                   IDDDNKKDDDDNKKDDNNYDNNDECDDDNKKDDNNYDNNNFIYDDDAINNNNNFIYDDA
FT                   INNNNFISDDAINNNNNFIYDDESNGDYSDDNPEEETEKYSQDEENNIRDIFEDSYNKD
FT                   NEINELLDDVNTSTFEDIEIIKYIYTNDDLKNKKSGLINIIRFPLLYEINLKKLMKIFC
FT                   FYEHIKKEEKINTIFHIEDIINSYYPLVYGHHFMYNEFLKNCKFFSFVLKKKKKITIPE
FT                   ELVVLIPHIEYNYKIDSYHFLKKLYYSVFNEPRICYTSINEQIKHINQMRYKLYVHNLK
FT                   TSKHFKNEKISSIHNNMISSYYIYQNHINNMIKNKTTCCINDDLWKTVLNPFDFFHLNN
FT                   DVNVFFEYNILTNIYNKFVTTVNTDFNKLCVNFYIKKDYKQYEEDNTNEHNSKRIMKRK
FT                   FNKNGLYNTIGDNKNKPPLLPTPKNESYKLVNSINNNHRHNINNMNNQRNGNRHKNNTN
FT                   NNTLLYKHATNNIQNNFNKSYRNENNIRNSMHNNNYDNNTKREDKNQKYVKNENQREGT
FT                   SRKNNASSVYRNYNVSNGNEHTNFNNNVSASHANFSYKPMRNNNNNNNNNMRGDNNSMR
FT                   GGYSMRNDQRNDQRNDQRNDQRNDHRNDHRNDHRNDHRNDHRNDHRNDHRNDHRNDHRN
FT                   DQRNDHRNSMRNDHRNSMRNDHRNSMRNDQRNSMMNDQRNSMMNDQRNSMMNDQRNVKR
FT                   RREESHEMNRRGDIYSNKRYDKRGRIDYDMKLKMDEKKNEKNIKNHSEMQDPYASTKDT
FT                   SRNFDMNNFTISSERKSWKLPPPPPNIPPSYDRSSQRRTSNFYNNDDSSM"
     atgaaaaata tgaatgatga gaatggtagt actatagagg gagatcctaa tactgaaaag        60
     gcaaagaata aaaataataa taataatgat gatattaatg aaaacattat agatgatgaa       120
     aaaaaaaaaa aagaacaaca acaagatgat gaagaagatg aagaagatga tgaagatgat       180
     gatgaagaag atgatgctga taatgatttg tgtgatcaaa atgttttaat aataggtgat       240
     gaaaatttat ctttttcaaa ttatataatc gaggcatatg catcatctaa tatatacata       300
     gcaagcacgc taacggaatt tcaggtgaac ttattgttga aagatctaga aaaaaaaaaa       360
     gtaaacaagt gcttacatga aaaaagagaa atagatgatg tgtcaacaaa ttatggtccc       420
     tttgatttta caaggaaatt taaagaaagg catgtaagca aaaatgtgca tattatattt       480
     aatgtcaact tatttaactt aaagtcgtat ttcccaaaga acttttttaa ggccgttttt       540
     ttgatacttc ccggcctgag ttttaatatt aacgatattc aactaaaata taatgacaaa       600
     gtaacgacct taagaatata ttattttcta attcttgtaa ctctggagat tacctacata       660
     agtatgaaaa attcaaatat tcatttattc tggactagcg aaaaattaaa aaactttgta       720
     gaaaatgagg aagaggaaga aaataataaa aatgaaccag atgatacgaa tgatttaaca       780
     caaaatgata tatcgttaaa cgataatgaa atttattcac atggtaatga tggatttaaa       840
     aaggaaagta tacatgatac gattaattcg ctcaagaatt taatgttcaa taatgtggag       900
     catgatcatg atgataatat ggatagtaat gcagatcata atatggatag taatgcagat       960
     cataacatgg atagtaatgc agatcataac atggatagta atgcagatca taacatggat      1020
     agtaatgaag atcataacat ggatagtaat acagatcata atatagatag taatacagat      1080
     cataacatgg atagtaatgc agatcataac atggatagta atacagatca taacatggat      1140
     aatgtagatg gcaccataaa ttatgaggaa gataataatt taaacggaca agatgaatac      1200
     tatgaagaaa acgaagaagg agattataca aatgaaaaag atgtaaattt aataaattct      1260
     tctgatataa atttagaaga taataatgag gatataagta accatgataa agaaaaagat      1320
     aataataata aaaaagatga tgatgataat aaaaaagatg atgataataa aatagatgat      1380
     gataataaaa tagatgatga tgataataaa atagatgatg ataataaaat agatgatgat      1440
     gataataaaa tagatgatga tgataataaa atagatgatg atgataataa aatagatgat      1500
     gatgataata aaaaagatga tgatgataat aaaaaagatg atgataataa aatagatgat      1560
     gataataaaa aagatgatga tgataataaa aaagatgata ataattatga taataatgat      1620
     gaatgtgatg atgataataa aaaagatgat aataattatg ataataacaa tttcatttat      1680
     gatgatgatg ccattaataa taataacaat ttcatctatg atgatgccat taataataac      1740
     aatttcattt ctgatgatgc cattaataat aataacaatt tcatctatga tgatgagagt      1800
     aatggtgatt atagtgatga taaccctgaa gaagaaacag aaaagtactc acaagatgaa      1860
     gagaataata taagagatat atttgaagat agttacaata aagataatga gatcaatgaa      1920
     ttattggacg atgtaaatac atctactttt gaagatatag aaataataaa atatatatat      1980
     actaatgatg atttaaaaaa taaaaagagt ggattaataa atataatacg ttttccattg      2040
     ttatatgaaa taaatttaaa aaaattaatg aagatttttt gtttttatga acatataaaa      2100
     aaagaagaaa aaataaatac aatattccat atagaagata ttataaatag ttactatcca      2160
     ttagtgtatg ggcatcattt tatgtataat gaatttttaa aaaattgtaa atttttttct      2220
     tttgttttaa aaaagaaaaa aaaaattacc ataccagaag aattagttgt cttgatacca      2280
     catattgaat ataattataa aatagattct tatcattttt taaaaaaatt atattattct      2340
     gtttttaacg aaccaagaat atgttataca tccataaatg aacaaataaa acatataaat      2400
     caaatgagat ataagttgta tgttcataat ttaaaaacat cgaaacattt taaaaacgaa      2460
     aaaatttcaa gtattcataa taatatgata tcatcttatt atatttatca aaatcatata      2520
     aataatatga taaaaaataa aacaacatgt tgtattaatg atgatttatg gaaaaccgta      2580
     ttgaatccat ttgatttttt tcatttgaat aatgatgtaa atgtattttt tgaatataat      2640
     attttaacaa atatttataa taaatttgtt acaacggtta acacggattt taataaattg      2700
     tgtgtaaatt tttatattaa aaaagattat aaacaatatg aagaagataa tacaaatgaa      2760
     cataactcaa aaagaatcat gaaaagaaaa tttaataaaa atggtcttta taataccata      2820
     ggtgataata aaaataaacc tcctttatta ccaacaccaa aaaatgaatc atataaactt      2880
     gtgaattcca tcaataataa tcatcgtcac aatattaata acatgaataa tcagagaaat      2940
     ggtaatcgtc ataagaataa cacaaataat aacacactct tatataaaca tgccactaat      3000
     aatatacaaa ataattttaa taaatcatat agaaatgaaa acaacattag aaatagcatg      3060
     cacaataata attatgacaa taacaccaaa agagaagaca aaaatcaaaa atatgtaaaa      3120
     aacgaaaacc aaagggaagg cacaagtaga aaaaataatg catcatctgt ttatcgaaat      3180
     tataatgttt caaatgggaa tgagcataca aattttaata ataatgtatc tgcatcgcac      3240
     gcaaactttt cttataagcc catgaggaat aataataata ataataataa taatatgagg      3300
     ggtgataata atagtatgag gggtggttat agtatgagaa atgatcaacg aaatgatcaa      3360
     cgaaatgatc aacgaaatga tcaacgaaat gatcatagga atgaccatag aaatgatcac      3420
     agaaatgatc acagaaatga tcacagaaat gatcacagaa atgatcacag aaatgatcat      3480
     agaaatgatc atagaaatga tcaaagaaat gatcatagaa atagtatgag gaatgaccat      3540
     agaaatagta tgaggaatga ccatagaaat agtatgagga atgatcaacg aaatagtatg      3600
     atgaatgatc aacgaaatag tatgatgaac gatcaacgaa atagtatgat gaacgatcaa      3660
     cgaaatgtta aacgaagaag agaagaatcg catgaaatga atagaagagg agatatatat      3720
     tcaaataaaa gatatgacaa aagaggaaga atagattatg atatgaaatt aaaaatggat      3780
     gagaaaaaaa atgagaaaaa tattaagaat cattcagaaa tgcaggatcc atatgcatca      3840
     acaaaagata cctctagaaa ttttgatatg aataatttta caattagttc tgaaaggaaa      3900
     tcatggaaat tacctcctcc acctcctaac attcctccat cctatgatag gtcatctcaa      3960
     cgaagaacga gcaattttta caataatgac gattcttcaa tgtaa                      4005
//

If you have problems or comments...

PBIL Back to PBIL home page