(data stored in ACNUC9543 zone)

EMBL: AL844507.PE76

AL844507.PE76        Location/Qualifiers
FT   CDS_pept        404996..409084
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0808000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0808000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.124:mRNA"
FT                   /db_xref="GOA:C0H4S9"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4S9"
FT                   /protein_id="CAX64105.1"
FT                   /translation="MKISNYIFGRIIDCYSYVDKIKTHVEFNRIKKYFQDAHILDKYLN
FT                   NYKSKIEYYRGKIKENVHSILRNNYICFEKNVDEDLIFVNRYVYYEIKNEDCIMICRKR
FT                   LKRNFFKKKREYIGKKKDYIENKNIYDYYDYYDYYDYNSLEELKKRKYISRYTSEVVVI
FT                   FPSYFFIKHFKILRDFIFFFIIERNNSPLNFCYIFKGTFRIYDRYIKEKITKNKIPCIL
FT                   ENICNEQLVLKNQLNKKKRRNKKLTNIELYNDIHLNVEQNKNVHYNNMCCNYDIYKKYF
FT                   INKKNNMFRCSNFILPIINKCIFLKGGILNVEFLKFSKKDIFFFTTHINKKYRCNQLFL
FT                   NGPKCFKILIYEEKEEEYFLNLYKSKDNKKTFLLSGSHLHNKLFLLNLQKICSKKKNRI
FT                   KNNYIIKQRKHLIIDVVKLISCRLRGKCFLENFYEYIVIICQGEKNHVHIFSVSTKDIN
FT                   YLKKKRISRKKYNNAKYVNNKKYLKNQQKKNQQKKNHICLEKYDNNICSNNICSNNICS
FT                   NNICSNNICSNNICSNNICSNNIYNNYYYNIFHCDHTKYRINIRKIEIPIDSKIKKLAT
FT                   LKNCNLQDFDMTKYGLVLYLYKYFLTPFICIIDLKNIFIKTYKKRANVVINNIVQCTNN
FT                   NKFYKSNDLRKIMKIVYLPIKKGSISCGINNNFYSPFISFDICNTFINNIKLRLYLKKG
FT                   VLCLLKNINNIEDSDFVCSSSSSLFESTYFKYDKELQKIFELHKNFCIKDVFLKTKDNK
FT                   KIAITLVYKRKDNHHICYGDRNNITSMNMSRMDNINDCIKRIFDNSGSNYEEGNKNKEN
FT                   MEITNFFDYIKNEEKKINIDNNKTYCDNNKTYCDNNKMCCDNKKMFCDNNKMCCDNNKM
FT                   CCDKHNICCDKHNICCDNHNICCDNHNICCDKHNICCDKHNICCDKHNICCDNHNICCD
FT                   NFVNDPHSDKCSNNIFNDLPIIFDYNLLSEMNMESYENFNFVLNEKNNLLVPHFVYPSK
FT                   TIIHVYPFYNEMNLCTYNDEYYFYLLNNFVISYFHLRGSGGLMCHKDEEGVRKKYIDKS
FT                   KEKKKILDDFIQCINFLKYKNISNTENISLYLYSNCGMIGGYILSCIFKIVKNIIFVNP
FT                   LLDIFNNLSDRNNPHVPSEYLEFGSMNINDYNIKKNIHISINKKNTNQIHFVYKKHCNG
FT                   YYNNDFKRKRKYIKGRYLKGTNKIVRNNNNNNNNNKNKYNSIPYYIYSMCPYYNIYPNY
FT                   KEHFCNNSNNISKEVFSLNKDNTNIFFKSNILLYLNKYDIICSNYNSIKYFTKYIHYKN
FT                   LTINYFYYYDNDQNILDESHKQHNNKLNFINFKNNNEQNENANFYISFSDKGGHSGYDS
FT                   SSGYLNNMLDKIFLHFFIN"
     atgaaaatta gtaattatat atttggtaga attatcgatt gttatagtta tgttgataaa        60
     ataaaaacac atgtagaatt taatagaata aaaaaatact ttcaagatgc tcatattctt       120
     gataaatatt tgaataatta taaaagtaaa atagaatatt atcgtgggaa aataaaggaa       180
     aatgtacatt caatattgag aaataactat atatgttttg agaaaaatgt agatgaggat       240
     ttaatttttg ttaataggta tgtttattat gagataaaaa atgaagactg tattatgata       300
     tgtcgaaaaa ggttgaaaag gaattttttt aaaaaaaaaa gagaatatat aggaaaaaaa       360
     aaggactata tagaaaataa aaatatatat gattattatg attattatga ttattatgat       420
     tataattcat tagaagaatt aaaaaagaga aaatatatat ctagatatac atccgaagta       480
     gttgttatat ttccttcata tttttttatt aaacatttta agattttaag ggattttata       540
     ttttttttta taattgaaag aaataatagt cctttgaatt tttgttatat atttaaaggg       600
     acctttcgta tttatgatag gtatataaaa gaaaaaataa ctaaaaataa gattccttgt       660
     attttggaaa acatttgtaa tgaacaattg gtgttaaaaa atcaactgaa taaaaaaaaa       720
     agaagaaata aaaaattaac aaacatagaa ttgtataatg atatacattt gaatgttgaa       780
     caaaataaaa atgttcatta taataatatg tgttgtaact atgatatata taagaaatat       840
     tttataaata agaaaaataa tatgtttaga tgttctaact ttatacttcc tattattaat       900
     aaatgtattt tcctcaaggg aggaatatta aatgttgaat ttttgaaatt ttcaaaaaaa       960
     gatatatttt tttttacaac acatataaat aaaaaatata ggtgtaacca attatttttg      1020
     aacgggccca aatgttttaa aatattaata tatgaagaaa aagaagaaga atatttttta      1080
     aatctataca aaagtaaaga taacaagaaa actttccttt tgagtggtag tcatttgcac      1140
     aataaattat ttttattgaa tctccaaaaa atatgctcaa aaaaaaaaaa tagaataaaa      1200
     aataattata taataaaaca aagaaaacat cttataattg atgtggttaa attaatttca      1260
     tgtcgtttaa gaggaaaatg ctttttagaa aatttttatg aatatattgt tataatatgt      1320
     caaggagaaa aaaatcatgt acacatattt tctgtatcta ctaaggatat taattatttg      1380
     aaaaaaaaaa gaatcagcag gaaaaaatat aataatgcga aatatgtgaa taataaaaaa      1440
     tatttaaaaa atcaacaaaa aaaaaatcaa caaaaaaaaa atcacatttg tttggagaaa      1500
     tatgataata atatatgtag taataatata tgtagtaata atatatgtag taataatata      1560
     tgtagtaata atatatgtag taataatata tgtagtaata atatatgtag taataatata      1620
     tataataatt attattataa tatattccat tgtgatcata caaaatatag gataaatata      1680
     agaaaaatcg aaattcctat agattcaaaa ataaaaaaac tagctacttt aaaaaattgt      1740
     aaccttcaag attttgatat gactaaatat ggtttagtac tctatctata taaatatttt      1800
     ttaacacctt tcatttgtat aattgattta aaaaatatat ttatcaagac atataagaaa      1860
     agagcgaatg tagttattaa taatatagtt caatgtacaa ataataacaa attttataaa      1920
     tctaatgatt taagaaagat tatgaagatt gtttatcttc ctataaagaa aggcagtata      1980
     tcatgtggta taaataacaa tttttatagt ccgtttattt catttgatat atgtaatact      2040
     tttattaaca acataaagtt aaggttatat ttaaaaaaag gagttttgtg tttattaaaa      2100
     aatataaata atattgagga tagcgatttt gtttgttcat cttcgtctag tttatttgaa      2160
     agtacttatt ttaagtatga taaggaatta caaaaaattt ttgaacttca taagaacttt      2220
     tgtattaaag atgttttttt aaaaacaaag gataataaaa aaattgctat tactttagta      2280
     tataagagga aggataatca tcatatatgt tatggtgatc ggaataatat cacgagtatg      2340
     aatatgagtc gaatggataa tattaatgat tgtataaagc ggatatttga taatagtggt      2400
     agtaattatg aggagggaaa taaaaataaa gaaaatatgg aaattactaa tttttttgat      2460
     tatataaaaa atgaggaaaa aaaaataaat atagacaata ataaaacata ttgtgataat      2520
     aataaaacat attgtgataa taacaaaatg tgttgtgata ataaaaaaat gttttgtgat      2580
     aataacaaaa tgtgttgtga taataacaaa atgtgttgtg ataaacataa tatatgctgt      2640
     gataaacata atatatgctg tgataatcat aatatatgtt gtgataatca taatatatgc      2700
     tgtgataaac ataatatatg ctgtgataaa cataatatat gttgtgataa acataatata      2760
     tgctgtgata atcataatat atgctgtgac aattttgtaa atgatccaca ttctgataag      2820
     tgtagcaata atatattcaa tgatcttcca ataatttttg attataattt attatcagaa      2880
     atgaatatgg agagctatga aaattttaat tttgtattaa acgaaaagaa taatttgtta      2940
     gttcctcatt ttgtttatcc tagtaaaact attattcacg tatacccttt ttataatgaa      3000
     atgaatttat gtacatacaa cgatgaatat tatttttatc ttttaaacaa ttttgtaata      3060
     tcttattttc atcttagagg ttcaggaggg ttaatgtgtc ataaggatga agaaggtgtg      3120
     agaaaaaaat atatagacaa aagtaaggaa aagaaaaaaa ttcttgatga tttcatacaa      3180
     tgtattaatt ttcttaaata taaaaatata agtaatacag aaaatatttc tttatattta      3240
     tattcaaatt gtggaatgat aggaggatat atattaagtt gtatatttaa aattgtaaaa      3300
     aatattatat ttgttaatcc tttattagat attttcaata acttaagcga tcgtaacaat      3360
     ccacatgtac cttcagaata tttagaattt ggatctatga atataaatga ttataatata      3420
     aaaaagaata tacatatatc tataaataaa aagaatacta atcaaatcca ttttgtttat      3480
     aagaaacatt gtaatggata ttacaacaat gattttaaaa ggaaaagaaa atatattaaa      3540
     ggtcgatatt taaaaggaac aaacaaaatt gttagaaata ataataataa taataataat      3600
     aataaaaata aatacaatag tataccttat tacatatatt caatgtgtcc atattataat      3660
     atatatccta attataaaga acatttttgt aataatagta acaacatatc aaaggaagta      3720
     ttttctttaa acaaggataa tactaatatt tttttcaaga gtaatattct tttatattta      3780
     aacaaatatg atattatatg ttctaattat aattctataa aatattttac aaaatatata      3840
     cattataaaa atctcacaat aaattatttt tattattatg ataatgatca aaatatacta      3900
     gatgaatcac ataagcaaca taacaataaa ttgaacttta taaattttaa aaataataat      3960
     gaacaaaatg aaaatgcaaa tttttatatt tctttttcgg ataagggtgg gcatagtgga      4020
     tatgattctt catcgggtta tttaaataat atgttggata aaatattttt acattttttt      4080
     ataaattaa                                                              4089
//

If you have problems or comments...

PBIL Back to PBIL home page